SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157736495|ref|YP_001489178.1| from Arcobacter butzleri RM4018

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157736495|ref|YP_001489178.1|
Domain Number 1 Region: 89-287
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 2.49e-34
Family MurCDEF 0.00042
Further Details:      
 
Domain Number 2 Region: 1-87
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 5.1e-25
Family MurCD N-terminal domain 0.00031
Further Details:      
 
Domain Number 3 Region: 288-432
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 1.36e-21
Family MurCDEF C-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157736495|ref|YP_001489178.1|
Sequence length 435
Comment UDP-N-acetylmuramate--L-alanine ligase [Arcobacter butzleri RM4018]
Sequence
MKVHFIGIGGIGLSALARFLNFDGHEVSGSDMKNSPITKALEDEGIKVSCPQDASNIKDD
FDLVIYSAAVTDENPELIQARLKQIRTLSRKEALPIILGDKKNYCVAGAHGKSTTTAMLA
SILNSSALIGAISKDFGSNFRYVDKLVAFEADESDASFLLSNPYCAIVTNAEPEHMEYYH
YDYDKFYESYEKFLSLAKVKVVNGEDKDVAKLKIENATILYPSKDIKNLCYTLKDNQPCT
KFDLKDLGTFEVWGFGFHMATNASLAILAALNELDIETIRKNLLNYKGIKKRFDIVQANE
KFVVIDDYAHHPTEIEATMKSIELYDNLTNLNKRIVLWQPHKYSRTSDNLEGFKKCFRRC
DELIILPLWTVAGEKKIEIDFPKEFASYNPIFADRVVATKGKIELIKDDKIIRTYEEGIF
LGVGAGDITYQLRLK
Download sequence
Identical sequences A8ERD5
gi|157736495|ref|YP_001489178.1| WP_012012101.1.47628 367737.Abu_0234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]