SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|88109|e_gw1.7.1575.1 from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triha1|88109|e_gw1.7.1575.1
Domain Number 1 Region: 2-364
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.26e-108
Family IF2B-like 0.000000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|88109|e_gw1.7.1575.1
Sequence length 386
Sequence
MSLLQAVKYQRGKLEVLDQLLLPHEFHYDTVSTRQEAFDSIATMRVRGAPAIAIVASLGL
AVELHNNPVSGTSDEQVISQIDEALDYLKQSRPTAVDLTNAITQLKATIRTADGKGKEAI
VQAFIEEAERIFEKDLQSNLSIGDFGAQWLQAQAGASPDQKISVLTHCNTGALATSGHGT
ALGIIRTLQSKGYLKHAFCTETRPYNQGSRLTAFELVHEGIPSTLITDSMAAALFRTKKA
ENNIAAVIVGADRVVRNGDTANKIGTYQLSVLAKHHGIKFIVAAPTTSIDLETKTGDGIK
IEERKREELTQISGAVVGPDGRVDGNNKVRVATADQRIDVWNPAFDVTPAEFIDVVVTEK
GAVEKGPDGTFDFSKILPKRWAKVVG
Download sequence
Identical sequences jgi|Triha1|88109|e_gw1.7.1575.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]