SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159040607|ref|YP_001539859.1| from Caldivirga maquilingensis IC-167

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159040607|ref|YP_001539859.1|
Domain Number 1 Region: 7-170
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.01e-61
Family Inorganic pyrophosphatase 0.00000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159040607|ref|YP_001539859.1|
Sequence length 185
Comment inorganic diphosphatase [Caldivirga maquilingensis IC-167]
Sequence
MVNITNLPPGRNPPDELYVVVEIPAGSNVKYEFDSASGVFIVDRVLYTAMSYPFNYGFIP
GTLTEDGDPLDAVVISSASFLPGTIVDVRPVGALNMEDEKGLDYKLITVPLSRVDPRFSM
IKDIKDLPDVILYQVRHFFEHYKELEPGKWTKVKEFMGVEEAKRLVLKYIRGKSNLTNSI
SQVHG
Download sequence
Identical sequences A8M9I8
WP_012185089.1.60673 gi|159040607|ref|YP_001539859.1| 397948.Cmaq_0015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]