SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159040612|ref|YP_001539864.1| from Caldivirga maquilingensis IC-167

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159040612|ref|YP_001539864.1|
Domain Number 1 Region: 5-445
Classification Level Classification E-value
Superfamily L-aspartase-like 7.7e-73
Family L-aspartase/fumarase 0.0000907
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|159040612|ref|YP_001539864.1|
Sequence length 470
Comment adenylosuccinate lyase [Caldivirga maquilingensis IC-167]
Sequence
MDILSPLDARYRNELKGYHEVASEDAFIMYRAKVELLYLEFLIDKLSKLGLVKPINDEEK
RRLRGIRLSSGDVNEVRRLEDELGHDVKALEYVLRGRLKAIGLEDYAHLIHLGLTSEDVN
NLAMGIMIKRILYEYLIPSLVDLGKVLVNLSNKYADTPMLARTHGQPATPTTFGKEIAYH
SHRLCSWISTLINLKINGKVAGASGSMASFTMIAQLDWPRELMNFVSSLGLEPTPVATQI
LPPDNLNHIIAAVGLTSYSLINLAQDMWMYSMLGYIKFKGRVIGSSTMPHKVNPVDLENA
EGNLKLGASMLMEISKILQSSRLQRDLSDSTIKRNLGLAMGYVVLGSRRLRKFMEGIEVN
EEALTNDLNNHWEVLSEAVQVRLRVLGQANAYEKSLKLFRVPRMSMSDYINAIKELGVND
ELLLNLRPSNYIGYASVIARNIAESCTQLLNKAEDTCIKESEAMSALGFK
Download sequence
Identical sequences A8M9J3
WP_012185094.1.60673 397948.Cmaq_0020 gi|159040612|ref|YP_001539864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]