SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159040756|ref|YP_001540008.1| from Caldivirga maquilingensis IC-167

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159040756|ref|YP_001540008.1|
Domain Number 1 Region: 168-284
Classification Level Classification E-value
Superfamily DNA primase core 0.00000000732
Family DNA primase DnaG catalytic core 0.019
Further Details:      
 
Weak hits

Sequence:  gi|159040756|ref|YP_001540008.1|
Domain Number - Region: 81-145
Classification Level Classification E-value
Superfamily HSC20 (HSCB), C-terminal oligomerisation domain 0.051
Family HSC20 (HSCB), C-terminal oligomerisation domain 0.018
Further Details:      
 
Domain Number - Region: 295-367
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0575
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|159040756|ref|YP_001540008.1|
Sequence length 452
Comment DNA primase [Caldivirga maquilingensis IC-167]
Sequence
MGALTISAKYLIELGFEVQGTVDKPDIIGALFSQTEGLLGSDLDLRELQNTSRIGRIEVE
VEHRGDKTVGKVYVPSNLDHYETALIAAMLETVDRVGPYNAKFQVNSIKDLRSEKRKLII
DRAKELIKLIERETIPDTKELMDKFLGEVKQGEVVSYGPEGLPAGPDVESSDTVIIVEGR
ADVVNLIKHGYRNVIAIEGASGGIPKTVIELSRRKTTIAFTDGDRGGEMILRELLKVADI
DYIARAPPGKEVEQLTAKEIAKALRNKIPVEEYINQLSKKDRQIIEESKKQIEQAQVQPS
AAPTSPQPQPESTQPTQPIQQVQVTQQTQVIEVPAQTQGQVQVTTMQQSTQQTPQLPTSV
VDEINKLSGTLEAIIYDKNWTVLKRVPVRDLLDTLQQVNDAYAIVFDGVGTQRLVDAAVG
KGIKMLIMTRIGNIAKVPSDMVILTFNDIINK
Download sequence
Identical sequences A8MA86
397948.Cmaq_0169 gi|159040756|ref|YP_001540008.1| WP_012185238.1.60673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]