SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159040793|ref|YP_001540045.1| from Caldivirga maquilingensis IC-167

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159040793|ref|YP_001540045.1|
Domain Number 1 Region: 6-76,162-342
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.7e-58
Family Bacterial dinuclear zinc exopeptidases 0.0000182
Further Details:      
 
Domain Number 2 Region: 66-170
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.45e-19
Family Aminopeptidase/glucanase lid domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|159040793|ref|YP_001540045.1|
Sequence length 350
Comment cellulase [Caldivirga maquilingensis IC-167]
Sequence
MDAATLSKLTLEIGPSGFEDRVIRTIISMIRNRVDEVNVDNMGNLIARIGNGPFKLMISA
HADEVGVMVSHIDQRGFIKVVPIGGIDPWVMIEQELVFMGRNGDIYGTVGVDPPHLRRDK
PPSRFEELYVDAGFTSNDEAFKAGILPGVAGTFAASFRERGSVVIGKALDNRVGCSVLVD
LAEEAGGMVTGDLSLYLVWNTQEEVGLRGINAAVNAINPNMAIVVETTVAADVPTNPENE
WITRIGNGAAIRALDRSMITNPRLLSAVLELASSRGIKYQVQVNPYGGTDAGAIHVHGTG
VPTVVVSTPARYIHTPHSVVNLSDVEQVKSMITLIVREHAELSRVMRIQA
Download sequence
Identical sequences A8MAL9
WP_012185275.1.60673 397948.Cmaq_0206 gi|159040793|ref|YP_001540045.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]