SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159041106|ref|YP_001540358.1| from Caldivirga maquilingensis IC-167

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159041106|ref|YP_001540358.1|
Domain Number 1 Region: 20-266
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.83e-58
Family Alanine racemase-like, N-terminal domain 0.00024
Further Details:      
 
Domain Number 2 Region: 246-397
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.51e-52
Family Eukaryotic ODC-like 0.0000698
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|159041106|ref|YP_001540358.1|
Sequence length 402
Comment diaminopimelate decarboxylase [Caldivirga maquilingensis IC-167]
Sequence
MDPCMISRGVSLVDLADKYDTPLIVYDLNLIEGNYRSIKDSLNAKVLYSIKANPNLAILA
FLRRLGSGADAASPGEVFLALKAGFKPSEVLYTGAYLSNNDIKYGIDSRVVLNFDSVRAF
ERAMALGYRPRLVFFRIDLGYGEGFTPGVTLAGEESKFGMFLNDAIKAYRLAKSNGVKEF
GIHAMMGSNVLNPDYFLKIAELLKEQAKVIEGEVGIKISYFDMGGGFGIPYKPGEKPLDL
NRLSALRGFFPGELWVEPGRFIVGNAGYLLTRVTEVKKKGNRTYIGVDVGMNVLIRPMLY
NAYHHIITCNEGEGSEIVDVVGPICENTDKLAINRELPRVKEGDLLVILNAGAYVYSMSS
NYNGRLRPAEVVVYNNEHAVSRFRETLDSLTMLQVIPSFIQQ
Download sequence
Identical sequences A8MC62
gi|159041106|ref|YP_001540358.1| WP_012185588.1.60673 397948.Cmaq_0523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]