SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159041113|ref|YP_001540365.1| from Caldivirga maquilingensis IC-167

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159041113|ref|YP_001540365.1|
Domain Number 1 Region: 1-355
Classification Level Classification E-value
Superfamily Chorismate synthase, AroC 8.11e-119
Family Chorismate synthase, AroC 0.000000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159041113|ref|YP_001540365.1|
Sequence length 365
Comment chorismate synthase [Caldivirga maquilingensis IC-167]
Sequence
MSSIGVVFRVTTFGESHGPAVGVVIDGVPAGIQLNEDYIRRELNRRRFCHIPVLNPRCED
EDFQILSGIKDGLTTGTPIAIVVWNKRAVSNYYMDIWMKPRPGHADLAWYLKFGKLYDFR
GGGRASGRETVARIAAGAVAKAILKQTIDVDVSSHLIELGGVSISRDDYTFNDVAKSWEK
PLPMIDDEAIEKAIKVLINAATEGDSVGGIGEVLTTEVPPGLGEPVFDKLKADLAKAVMS
IPSTTGIEFGLGFKLARMRGSEANDQIVLRNGKPRLETNRVGGMLGGMSIGEPIRFRVAF
KPTPSIRRPQRTVDLEKITETTITFTGRYDISTAPKAILAAEAMTAIILVDHAIRAGLIP
RIIRK
Download sequence
Identical sequences A8MC69
WP_012185595.1.60673 397948.Cmaq_0530 gi|159041113|ref|YP_001540365.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]