SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159041964|ref|YP_001541216.1| from Caldivirga maquilingensis IC-167

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159041964|ref|YP_001541216.1|
Domain Number 1 Region: 1-205
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.56e-53
Family Phosphate binding protein-like 0.000072
Further Details:      
 
Domain Number 2 Region: 211-282
Classification Level Classification E-value
Superfamily GlnB-like 1.78e-17
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|159041964|ref|YP_001541216.1|
Sequence length 283
Comment ATP phosphoribosyltransferase [Caldivirga maquilingensis IC-167]
Sequence
MAIPSKGRLVEPVMSLLNYVGIKPQSMDDRALVLPTSWRSLSLIRIRPEDIPSVVESNSA
IMGITGLDYVVENGASVNVVERLGFGRGRIVIAVPSGSGISSIDEIKDGFRLATKYVNIT
SAYFSKLGRRVRIVRISGSAEVMPLLNVADGIVDVMSTGTTLRLHGLKPIGVIMESEAVL
VTPRELNGDEREFVDKFLILMRGALASNGRKLILMNVPEEDLAAVLKVLPAMEGPTVADV
ASGKPMKEVISVVPEESIPDLLPLLKRAGAKDILVLSIEKVIP
Download sequence
Identical sequences A8M907
397948.Cmaq_1400 gi|159041964|ref|YP_001541216.1| WP_012186445.1.60673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]