SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159042243|ref|YP_001541495.1| from Caldivirga maquilingensis IC-167

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159042243|ref|YP_001541495.1|
Domain Number 1 Region: 2-228
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.9e-56
Family Outer surface protein, N-terminal domain 0.00017
Further Details:      
 
Domain Number 2 Region: 234-331
Classification Level Classification E-value
Superfamily Cyclophilin-like 0.0000000000091
Family Outer surface protein, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159042243|ref|YP_001541495.1|
Sequence length 356
Comment hypothetical protein Cmaq_1682 [Caldivirga maquilingensis IC-167]
Sequence
MVKSIGISFAVGRRETVPRTMEIMRKASELGFTEVWSGVGLDSLDLVKDIAKLANELGYY
YFVDINPRVLSDLGASPGDLSFFRKMGIKGVRADWGFNLEQLATMANNDLGIKVELNASV
FPLDELDKLLKLVRKPENLMASHDWYPWEYTGLSLEDALAKSREFHNRGIPVGIFVSVKD
GERTTVESLRHMDIENSASILLNSRYIDRVLIGDPLPSDEDLRKVANAKRRTRIRVITYY
GLTEEEAKVFNREFHDVRIKEKTIGLTAGGENNIKPRNIVRRFKGAVTVVNDNPHYIQVW
IFKDDAPPDPRFNVIGEVYPEDMPIVEHLAERTKGILSVPVNDDVPPVVLEQYKSA
Download sequence
Identical sequences A8MAC8
397948.Cmaq_1682 WP_012186724.1.60673 gi|159042243|ref|YP_001541495.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]