SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159042473|ref|YP_001541725.1| from Caldivirga maquilingensis IC-167

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159042473|ref|YP_001541725.1|
Domain Number 1 Region: 4-239
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 4.45e-66
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000291
Further Details:      
 
Domain Number 2 Region: 226-377
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 2.26e-42
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|159042473|ref|YP_001541725.1|
Sequence length 379
Comment acyl-CoA dehydrogenase domain-containing protein [Caldivirga maquilingensis IC-167]
Sequence
MHPLLEEVHELLRRSTVEFAEARVEPLAKAIEVNGEYPRQLMGELGKQGLLAPMAPPEYG
GGGLDFRGEVIIIEEVAKHSPTLATLMEVQGALIIDSLLSHGSREVRERFLEGLVKGDLI
ASFALTEPCCGSDAGAIETRAVKDGGEWVINGRKAWVTSGQYADLYLVFARTGSIEERHR
AITAFLVPRGGCIEVNPMGVMGIRGGGTAEVSLRDCRVPDEYRVGEVNRGFYLAMEKLNL
GRTCVGAIGLGIAERAFTEAYDYAQVRRIYGGTLAELGVIQGYLAQMYTQVEALRGLIYL
TAYMRDKGLSEFTKYAQAAKYLGSSTAVNVTRTAIQVMGAVGLSTESPLEYLYRDAKATE
VYEGSNEVILYSLFKMLRK
Download sequence
Identical sequences A8MBK2
397948.Cmaq_1918 gi|159042473|ref|YP_001541725.1| WP_012186954.1.60673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]