SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161509565|ref|YP_001575224.1| from Staphylococcus aureus subsp. aureus USA300_TCH1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161509565|ref|YP_001575224.1|
Domain Number 1 Region: 23-226
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.74e-33
Family Alanine racemase-like, N-terminal domain 0.0008
Further Details:      
 
Domain Number 2 Region: 230-350
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.07e-24
Family Alanine racemase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161509565|ref|YP_001575224.1|
Sequence length 361
Comment alanine racemase [Staphylococcus aureus subsp. aureus USA300_TCH1516]
Sequence
MTATWSVNKKIFLQNAITVKNNQPLMAVVKNNAYHYDLEFAVTQFIHAGIDTFSTTSLRE
AIQIRQLAPDATIFLMNAVYEFDLVREHQIHMTLPSLTYYYNHKNDLAGIHVHLEFENLL
HRSGFKDLNEIKEVLKDHHHNQNAKMIISGLWTHFGYADEFDVSDYNVERSQWMEIVEAL
LSEGYQFDLIHAQNSASFYREGQILLPHHTHARVGIALYGSRPYSSLNQHDIVQSLTLKA
HVIQVREVQAGDYCGYSFAFEVTKNNTKLAVVDIGYGDGILRTRAKHEALINGKRYPIRA
LMMSHMFVEVDGNVHAQDEVILYNNDIRIDEYTFKGVGANSEQLSAMNHDSLKKEYISND
C
Download sequence
Identical sequences A0A0D6HLY8 A0A0E1AK68 A0A0H2XI95 A0A0H3K8K8 A0A1E8XCQ9 A0A2K1AD36 Q5HG21 Q9EZ08
gi|161509565|ref|YP_001575224.1| gi|87161172|ref|YP_493989.1| gi|57651899|ref|YP_186286.1| gi|387143011|ref|YP_005731404.1| gi|479329319|ref|YP_007868378.1| 426430.NWMN_1310 451515.SAUSA300_1292 451516.USA300HOU_1334 93061.SAOUHSC_01400 93062.SACOL1434 gi|384869940|ref|YP_005752654.1| gi|384861999|ref|YP_005744719.1| gi|521211993|ref|YP_008168339.1| gi|151221522|ref|YP_001332344.1| WP_000127593.1.100013 WP_000127593.1.100041 WP_000127593.1.100049 WP_000127593.1.100057 WP_000127593.1.10006 WP_000127593.1.100067 WP_000127593.1.100072 WP_000127593.1.100088 WP_000127593.1.100090 WP_000127593.1.100094 WP_000127593.1.100154 WP_000127593.1.100180 WP_000127593.1.100189 WP_000127593.1.100298 WP_000127593.1.100307 WP_000127593.1.100352 WP_000127593.1.100391 WP_000127593.1.10041 WP_000127593.1.100618 WP_000127593.1.100631 WP_000127593.1.100647 WP_000127593.1.100761 WP_000127593.1.100768 WP_000127593.1.100834 WP_000127593.1.100903 WP_000127593.1.100920 WP_000127593.1.100963 WP_000127593.1.100981 WP_000127593.1.100987 WP_000127593.1.101017 WP_000127593.1.101058 WP_000127593.1.101084 WP_000127593.1.101177 WP_000127593.1.101240 WP_000127593.1.101266 WP_000127593.1.101327 WP_000127593.1.101329 WP_000127593.1.101375 WP_000127593.1.101393 WP_000127593.1.101490 WP_000127593.1.101505 WP_000127593.1.101566 WP_000127593.1.101570 WP_000127593.1.101615 WP_000127593.1.10166 WP_000127593.1.101725 WP_000127593.1.101757 WP_000127593.1.101788 WP_000127593.1.101950 WP_000127593.1.1022 WP_000127593.1.10232 WP_000127593.1.10397 WP_000127593.1.10431 WP_000127593.1.10486 WP_000127593.1.10503 WP_000127593.1.10542 WP_000127593.1.10543 WP_000127593.1.10565 WP_000127593.1.10614 WP_000127593.1.10679 WP_000127593.1.10707 WP_000127593.1.10726 WP_000127593.1.10742 WP_000127593.1.10950 WP_000127593.1.10985 WP_000127593.1.11129 WP_000127593.1.1120 WP_000127593.1.11287 WP_000127593.1.11294 WP_000127593.1.11348 WP_000127593.1.11353 WP_000127593.1.1136 WP_000127593.1.11377 WP_000127593.1.11407 WP_000127593.1.11488 WP_000127593.1.11492 WP_000127593.1.11525 WP_000127593.1.11558 WP_000127593.1.11592 WP_000127593.1.11665 WP_000127593.1.11692 WP_000127593.1.117 WP_000127593.1.11719 WP_000127593.1.11795 WP_000127593.1.11829 WP_000127593.1.11991 WP_000127593.1.12005 WP_000127593.1.1205 WP_000127593.1.12073 WP_000127593.1.12098 WP_000127593.1.12123 WP_000127593.1.12179 WP_000127593.1.12181 WP_000127593.1.12226 WP_000127593.1.12233 WP_000127593.1.12297 WP_000127593.1.12328 WP_000127593.1.12361 WP_000127593.1.12366 WP_000127593.1.12391 WP_000127593.1.12436 WP_000127593.1.12447 WP_000127593.1.12498 WP_000127593.1.12639 WP_000127593.1.12715 WP_000127593.1.12771 WP_000127593.1.12822 WP_000127593.1.12833 WP_000127593.1.12845 WP_000127593.1.12862 WP_000127593.1.12937 WP_000127593.1.12938 WP_000127593.1.13039 WP_000127593.1.13072 WP_000127593.1.13091 WP_000127593.1.13104 WP_000127593.1.13322 WP_000127593.1.13468 WP_000127593.1.1347 WP_000127593.1.13531 WP_000127593.1.1355 WP_000127593.1.13556 WP_000127593.1.13568 WP_000127593.1.13617 WP_000127593.1.13654 WP_000127593.1.13683 WP_000127593.1.13726 WP_000127593.1.13727 WP_000127593.1.1374 WP_000127593.1.13755 WP_000127593.1.13757 WP_000127593.1.13772 WP_000127593.1.13804 WP_000127593.1.13805 WP_000127593.1.13914 WP_000127593.1.13940 WP_000127593.1.13983 WP_000127593.1.14071 WP_000127593.1.14112 WP_000127593.1.14153 WP_000127593.1.14233 WP_000127593.1.1426 WP_000127593.1.14364 WP_000127593.1.14365 WP_000127593.1.14366 WP_000127593.1.14394 WP_000127593.1.14418 WP_000127593.1.14475 WP_000127593.1.147 WP_000127593.1.14744 WP_000127593.1.1477 WP_000127593.1.14790 WP_000127593.1.14809 WP_000127593.1.14869 WP_000127593.1.14888 WP_000127593.1.14902 WP_000127593.1.14987 WP_000127593.1.15000 WP_000127593.1.15091 WP_000127593.1.15228 WP_000127593.1.15255 WP_000127593.1.15263 WP_000127593.1.15278 WP_000127593.1.15329 WP_000127593.1.15399 WP_000127593.1.15409 WP_000127593.1.15438 WP_000127593.1.1545 WP_000127593.1.15489 WP_000127593.1.15524 WP_000127593.1.15572 WP_000127593.1.15687 WP_000127593.1.15706 WP_000127593.1.1579 WP_000127593.1.15818 WP_000127593.1.1583 WP_000127593.1.15838 WP_000127593.1.15883 WP_000127593.1.15892 WP_000127593.1.15897 WP_000127593.1.15898 WP_000127593.1.15928 WP_000127593.1.15957 WP_000127593.1.15972 WP_000127593.1.1600 WP_000127593.1.1606 WP_000127593.1.16112 WP_000127593.1.16213 WP_000127593.1.16237 WP_000127593.1.16362 WP_000127593.1.16417 WP_000127593.1.16554 WP_000127593.1.16569 WP_000127593.1.16603 WP_000127593.1.16617 WP_000127593.1.16628 WP_000127593.1.16679 WP_000127593.1.16688 WP_000127593.1.16703 WP_000127593.1.16757 WP_000127593.1.16768 WP_000127593.1.16770 WP_000127593.1.16776 WP_000127593.1.16892 WP_000127593.1.16946 WP_000127593.1.170 WP_000127593.1.17012 WP_000127593.1.17038 WP_000127593.1.17104 WP_000127593.1.17137 WP_000127593.1.17169 WP_000127593.1.17210 WP_000127593.1.17231 WP_000127593.1.17234 WP_000127593.1.17249 WP_000127593.1.17256 WP_000127593.1.17320 WP_000127593.1.17450 WP_000127593.1.17485 WP_000127593.1.17520 WP_000127593.1.17581 WP_000127593.1.17650 WP_000127593.1.17657 WP_000127593.1.17666 WP_000127593.1.17770 WP_000127593.1.17834 WP_000127593.1.17845 WP_000127593.1.17859 WP_000127593.1.17876 WP_000127593.1.17929 WP_000127593.1.17951 WP_000127593.1.18035 WP_000127593.1.18074 WP_000127593.1.18105 WP_000127593.1.18197 WP_000127593.1.18283 WP_000127593.1.18290 WP_000127593.1.18320 WP_000127593.1.1835 WP_000127593.1.18437 WP_000127593.1.18451 WP_000127593.1.1851 WP_000127593.1.18516 WP_000127593.1.18529 WP_000127593.1.18538 WP_000127593.1.18562 WP_000127593.1.18611 WP_000127593.1.18627 WP_000127593.1.18668 WP_000127593.1.18758 WP_000127593.1.18809 WP_000127593.1.18830 WP_000127593.1.18836 WP_000127593.1.18879 WP_000127593.1.18918 WP_000127593.1.18938 WP_000127593.1.18987 WP_000127593.1.19009 WP_000127593.1.1901 WP_000127593.1.19027 WP_000127593.1.19149 WP_000127593.1.19179 WP_000127593.1.192 WP_000127593.1.19272 WP_000127593.1.19390 WP_000127593.1.19411 WP_000127593.1.19444 WP_000127593.1.19509 WP_000127593.1.19733 WP_000127593.1.1975 WP_000127593.1.19765 WP_000127593.1.19775 WP_000127593.1.19807 WP_000127593.1.19853 WP_000127593.1.20057 WP_000127593.1.20101 WP_000127593.1.2013 WP_000127593.1.20155 WP_000127593.1.20160 WP_000127593.1.20210 WP_000127593.1.20354 WP_000127593.1.20386 WP_000127593.1.20473 WP_000127593.1.20554 WP_000127593.1.20833 WP_000127593.1.20838 WP_000127593.1.20860 WP_000127593.1.20975 WP_000127593.1.21013 WP_000127593.1.21054 WP_000127593.1.21080 WP_000127593.1.21081 WP_000127593.1.2128 WP_000127593.1.21312 WP_000127593.1.21330 WP_000127593.1.21356 WP_000127593.1.21386 WP_000127593.1.21402 WP_000127593.1.21465 WP_000127593.1.21511 WP_000127593.1.2154 WP_000127593.1.21583 WP_000127593.1.21601 WP_000127593.1.21679 WP_000127593.1.21712 WP_000127593.1.21820 WP_000127593.1.21890 WP_000127593.1.21901 WP_000127593.1.22045 WP_000127593.1.22163 WP_000127593.1.22165 WP_000127593.1.22170 WP_000127593.1.22174 WP_000127593.1.22246 WP_000127593.1.22332 WP_000127593.1.22344 WP_000127593.1.22351 WP_000127593.1.22367 WP_000127593.1.22526 WP_000127593.1.22531 WP_000127593.1.22551 WP_000127593.1.22657 WP_000127593.1.22730 WP_000127593.1.22731 WP_000127593.1.2280 WP_000127593.1.22811 WP_000127593.1.22843 WP_000127593.1.22859 WP_000127593.1.22994 WP_000127593.1.23004 WP_000127593.1.23152 WP_000127593.1.23228 WP_000127593.1.23238 WP_000127593.1.23381 WP_000127593.1.23420 WP_000127593.1.23450 WP_000127593.1.23489 WP_000127593.1.23491 WP_000127593.1.23541 WP_000127593.1.23544 WP_000127593.1.23586 WP_000127593.1.23613 WP_000127593.1.23626 WP_000127593.1.2365 WP_000127593.1.23822 WP_000127593.1.23849 WP_000127593.1.23907 WP_000127593.1.23935 WP_000127593.1.23998 WP_000127593.1.24148 WP_000127593.1.24167 WP_000127593.1.2423 WP_000127593.1.24241 WP_000127593.1.24279 WP_000127593.1.24364 WP_000127593.1.24418 WP_000127593.1.2442 WP_000127593.1.24443 WP_000127593.1.24478 WP_000127593.1.2458 WP_000127593.1.24617 WP_000127593.1.24684 WP_000127593.1.24745 WP_000127593.1.24781 WP_000127593.1.2480 WP_000127593.1.24802 WP_000127593.1.24891 WP_000127593.1.24903 WP_000127593.1.25083 WP_000127593.1.25120 WP_000127593.1.25170 WP_000127593.1.25433 WP_000127593.1.25438 WP_000127593.1.25469 WP_000127593.1.25479 WP_000127593.1.25511 WP_000127593.1.25567 WP_000127593.1.25593 WP_000127593.1.25634 WP_000127593.1.25737 WP_000127593.1.25770 WP_000127593.1.2579 WP_000127593.1.25820 WP_000127593.1.25867 WP_000127593.1.25868 WP_000127593.1.25881 WP_000127593.1.25891 WP_000127593.1.25924 WP_000127593.1.2593 WP_000127593.1.26006 WP_000127593.1.26015 WP_000127593.1.262 WP_000127593.1.26293 WP_000127593.1.26307 WP_000127593.1.2633 WP_000127593.1.26370 WP_000127593.1.26405 WP_000127593.1.26481 WP_000127593.1.2656 WP_000127593.1.2658 WP_000127593.1.2661 WP_000127593.1.26626 WP_000127593.1.2664 WP_000127593.1.26663 WP_000127593.1.26733 WP_000127593.1.26771 WP_000127593.1.26790 WP_000127593.1.26927 WP_000127593.1.26958 WP_000127593.1.27042 WP_000127593.1.27154 WP_000127593.1.27246 WP_000127593.1.27311 WP_000127593.1.27333 WP_000127593.1.2734 WP_000127593.1.27345 WP_000127593.1.27455 WP_000127593.1.27457 WP_000127593.1.27551 WP_000127593.1.27562 WP_000127593.1.2759 WP_000127593.1.27608 WP_000127593.1.27614 WP_000127593.1.27615 WP_000127593.1.27621 WP_000127593.1.27654 WP_000127593.1.27670 WP_000127593.1.2768 WP_000127593.1.27717 WP_000127593.1.27748 WP_000127593.1.27817 WP_000127593.1.27854 WP_000127593.1.27950 WP_000127593.1.27953 WP_000127593.1.27972 WP_000127593.1.28007 WP_000127593.1.28025 WP_000127593.1.28063 WP_000127593.1.28071 WP_000127593.1.28088 WP_000127593.1.28117 WP_000127593.1.28138 WP_000127593.1.28147 WP_000127593.1.28158 WP_000127593.1.28191 WP_000127593.1.28207 WP_000127593.1.28334 WP_000127593.1.28358 WP_000127593.1.28360 WP_000127593.1.28376 WP_000127593.1.28381 WP_000127593.1.28399 WP_000127593.1.28477 WP_000127593.1.28498 WP_000127593.1.28502 WP_000127593.1.28527 WP_000127593.1.28532 WP_000127593.1.28629 WP_000127593.1.28650 WP_000127593.1.28710 WP_000127593.1.28725 WP_000127593.1.28862 WP_000127593.1.28887 WP_000127593.1.28933 WP_000127593.1.28960 WP_000127593.1.28970 WP_000127593.1.29090 WP_000127593.1.29107 WP_000127593.1.29188 WP_000127593.1.29207 WP_000127593.1.29243 WP_000127593.1.29272 WP_000127593.1.29282 WP_000127593.1.29285 WP_000127593.1.29312 WP_000127593.1.29372 WP_000127593.1.29373 WP_000127593.1.29381 WP_000127593.1.29511 WP_000127593.1.29541 WP_000127593.1.29553 WP_000127593.1.29561 WP_000127593.1.29596 WP_000127593.1.29644 WP_000127593.1.29676 WP_000127593.1.2975 WP_000127593.1.29758 WP_000127593.1.29781 WP_000127593.1.29805 WP_000127593.1.29885 WP_000127593.1.29963 WP_000127593.1.30012 WP_000127593.1.30023 WP_000127593.1.30033 WP_000127593.1.30047 WP_000127593.1.30057 WP_000127593.1.30154 WP_000127593.1.30176 WP_000127593.1.30274 WP_000127593.1.30367 WP_000127593.1.30376 WP_000127593.1.30381 WP_000127593.1.30418 WP_000127593.1.30422 WP_000127593.1.30477 WP_000127593.1.30530 WP_000127593.1.30623 WP_000127593.1.30758 WP_000127593.1.30779 WP_000127593.1.30862 WP_000127593.1.30863 WP_000127593.1.30874 WP_000127593.1.30878 WP_000127593.1.30889 WP_000127593.1.30916 WP_000127593.1.3097 WP_000127593.1.30970 WP_000127593.1.30971 WP_000127593.1.30998 WP_000127593.1.31068 WP_000127593.1.31124 WP_000127593.1.31194 WP_000127593.1.31232 WP_000127593.1.31376 WP_000127593.1.31462 WP_000127593.1.31478 WP_000127593.1.315 WP_000127593.1.31567 WP_000127593.1.31611 WP_000127593.1.31638 WP_000127593.1.31667 WP_000127593.1.31787 WP_000127593.1.31797 WP_000127593.1.31817 WP_000127593.1.31897 WP_000127593.1.31925 WP_000127593.1.31949 WP_000127593.1.31990 WP_000127593.1.31994 WP_000127593.1.32118 WP_000127593.1.32122 WP_000127593.1.32125 WP_000127593.1.32167 WP_000127593.1.32217 WP_000127593.1.32244 WP_000127593.1.32248 WP_000127593.1.32281 WP_000127593.1.32295 WP_000127593.1.32365 WP_000127593.1.32384 WP_000127593.1.32405 WP_000127593.1.3244 WP_000127593.1.32454 WP_000127593.1.32464 WP_000127593.1.32739 WP_000127593.1.32839 WP_000127593.1.32921 WP_000127593.1.32987 WP_000127593.1.3299 WP_000127593.1.3306 WP_000127593.1.33067 WP_000127593.1.33108 WP_000127593.1.33147 WP_000127593.1.33213 WP_000127593.1.33252 WP_000127593.1.33255 WP_000127593.1.33307 WP_000127593.1.3335 WP_000127593.1.33350 WP_000127593.1.33372 WP_000127593.1.3338 WP_000127593.1.33388 WP_000127593.1.33394 WP_000127593.1.33426 WP_000127593.1.3345 WP_000127593.1.33463 WP_000127593.1.33483 WP_000127593.1.33484 WP_000127593.1.33520 WP_000127593.1.33575 WP_000127593.1.33650 WP_000127593.1.33724 WP_000127593.1.33737 WP_000127593.1.33756 WP_000127593.1.33766 WP_000127593.1.33778 WP_000127593.1.33899 WP_000127593.1.33940 WP_000127593.1.33949 WP_000127593.1.33994 WP_000127593.1.34069 WP_000127593.1.34105 WP_000127593.1.34112 WP_000127593.1.3418 WP_000127593.1.34194 WP_000127593.1.34361 WP_000127593.1.3442 WP_000127593.1.34436 WP_000127593.1.34471 WP_000127593.1.34512 WP_000127593.1.34569 WP_000127593.1.34716 WP_000127593.1.34723 WP_000127593.1.3474 WP_000127593.1.34741 WP_000127593.1.34847 WP_000127593.1.34865 WP_000127593.1.34923 WP_000127593.1.34926 WP_000127593.1.34967 WP_000127593.1.35031 WP_000127593.1.35032 WP_000127593.1.35289 WP_000127593.1.35314 WP_000127593.1.35340 WP_000127593.1.35391 WP_000127593.1.35413 WP_000127593.1.35508 WP_000127593.1.35517 WP_000127593.1.35519 WP_000127593.1.35549 WP_000127593.1.35642 WP_000127593.1.35661 WP_000127593.1.35686 WP_000127593.1.35696 WP_000127593.1.35784 WP_000127593.1.3579 WP_000127593.1.35837 WP_000127593.1.35890 WP_000127593.1.35903 WP_000127593.1.36093 WP_000127593.1.36179 WP_000127593.1.36208 WP_000127593.1.36249 WP_000127593.1.36302 WP_000127593.1.36430 WP_000127593.1.36434 WP_000127593.1.36439 WP_000127593.1.36640 WP_000127593.1.36704 WP_000127593.1.36773 WP_000127593.1.36814 WP_000127593.1.36847 WP_000127593.1.36888 WP_000127593.1.36903 WP_000127593.1.36911 WP_000127593.1.3709 WP_000127593.1.37120 WP_000127593.1.37130 WP_000127593.1.37145 WP_000127593.1.37159 WP_000127593.1.3722 WP_000127593.1.37240 WP_000127593.1.37335 WP_000127593.1.37378 WP_000127593.1.37411 WP_000127593.1.37435 WP_000127593.1.37546 WP_000127593.1.37644 WP_000127593.1.37669 WP_000127593.1.37679 WP_000127593.1.3774 WP_000127593.1.37749 WP_000127593.1.37764 WP_000127593.1.37771 WP_000127593.1.37788 WP_000127593.1.37851 WP_000127593.1.37906 WP_000127593.1.37907 WP_000127593.1.37929 WP_000127593.1.38030 WP_000127593.1.38111 WP_000127593.1.38128 WP_000127593.1.38136 WP_000127593.1.38222 WP_000127593.1.38304 WP_000127593.1.38516 WP_000127593.1.38555 WP_000127593.1.38688 WP_000127593.1.3875 WP_000127593.1.38875 WP_000127593.1.38885 WP_000127593.1.38890 WP_000127593.1.38927 WP_000127593.1.39017 WP_000127593.1.39026 WP_000127593.1.39166 WP_000127593.1.39330 WP_000127593.1.39361 WP_000127593.1.39432 WP_000127593.1.39499 WP_000127593.1.39542 WP_000127593.1.39642 WP_000127593.1.39670 WP_000127593.1.39671 WP_000127593.1.39682 WP_000127593.1.39693 WP_000127593.1.39857 WP_000127593.1.39943 WP_000127593.1.39995 WP_000127593.1.40076 WP_000127593.1.4010 WP_000127593.1.40149 WP_000127593.1.40247 WP_000127593.1.40329 WP_000127593.1.40369 WP_000127593.1.40428 WP_000127593.1.40483 WP_000127593.1.40500 WP_000127593.1.40670 WP_000127593.1.40700 WP_000127593.1.40719 WP_000127593.1.40729 WP_000127593.1.40780 WP_000127593.1.40814 WP_000127593.1.40939 WP_000127593.1.40997 WP_000127593.1.41033 WP_000127593.1.41038 WP_000127593.1.4105 WP_000127593.1.41350 WP_000127593.1.41374 WP_000127593.1.41386 WP_000127593.1.41389 WP_000127593.1.41555 WP_000127593.1.41581 WP_000127593.1.41587 WP_000127593.1.41598 WP_000127593.1.41612 WP_000127593.1.41620 WP_000127593.1.41681 WP_000127593.1.4169 WP_000127593.1.41743 WP_000127593.1.41755 WP_000127593.1.41796 WP_000127593.1.4182 WP_000127593.1.41863 WP_000127593.1.41972 WP_000127593.1.42003 WP_000127593.1.4202 WP_000127593.1.42056 WP_000127593.1.42064 WP_000127593.1.42072 WP_000127593.1.42085 WP_000127593.1.42169 WP_000127593.1.42178 WP_000127593.1.42241 WP_000127593.1.4225 WP_000127593.1.42298 WP_000127593.1.42325 WP_000127593.1.42344 WP_000127593.1.42607 WP_000127593.1.42681 WP_000127593.1.42733 WP_000127593.1.42764 WP_000127593.1.42788 WP_000127593.1.42798 WP_000127593.1.42816 WP_000127593.1.42897 WP_000127593.1.42907 WP_000127593.1.42925 WP_000127593.1.42959 WP_000127593.1.42984 WP_000127593.1.42990 WP_000127593.1.43023 WP_000127593.1.43061 WP_000127593.1.43095 WP_000127593.1.43110 WP_000127593.1.43125 WP_000127593.1.43139 WP_000127593.1.43168 WP_000127593.1.43179 WP_000127593.1.43204 WP_000127593.1.43252 WP_000127593.1.43279 WP_000127593.1.43360 WP_000127593.1.43375 WP_000127593.1.43405 WP_000127593.1.43446 WP_000127593.1.43512 WP_000127593.1.43665 WP_000127593.1.43784 WP_000127593.1.4386 WP_000127593.1.43995 WP_000127593.1.44074 WP_000127593.1.44177 WP_000127593.1.44178 WP_000127593.1.44344 WP_000127593.1.44382 WP_000127593.1.44432 WP_000127593.1.44504 WP_000127593.1.44515 WP_000127593.1.44520 WP_000127593.1.44586 WP_000127593.1.44623 WP_000127593.1.44655 WP_000127593.1.44667 WP_000127593.1.447 WP_000127593.1.44714 WP_000127593.1.44715 WP_000127593.1.44780 WP_000127593.1.44856 WP_000127593.1.44868 WP_000127593.1.44876 WP_000127593.1.44892 WP_000127593.1.44940 WP_000127593.1.44993 WP_000127593.1.45042 WP_000127593.1.45080 WP_000127593.1.45091 WP_000127593.1.45094 WP_000127593.1.45140 WP_000127593.1.45157 WP_000127593.1.45162 WP_000127593.1.45223 WP_000127593.1.45242 WP_000127593.1.45267 WP_000127593.1.4527 WP_000127593.1.45281 WP_000127593.1.45419 WP_000127593.1.4545 WP_000127593.1.45450 WP_000127593.1.45456 WP_000127593.1.4546 WP_000127593.1.45542 WP_000127593.1.45555 WP_000127593.1.45574 WP_000127593.1.45610 WP_000127593.1.45645 WP_000127593.1.45705 WP_000127593.1.45763 WP_000127593.1.4577 WP_000127593.1.45773 WP_000127593.1.4582 WP_000127593.1.45859 WP_000127593.1.45862 WP_000127593.1.45874 WP_000127593.1.4597 WP_000127593.1.45972 WP_000127593.1.45977 WP_000127593.1.45979 WP_000127593.1.46037 WP_000127593.1.46050 WP_000127593.1.46062 WP_000127593.1.46078 WP_000127593.1.46171 WP_000127593.1.46172 WP_000127593.1.46185 WP_000127593.1.46248 WP_000127593.1.46333 WP_000127593.1.46339 WP_000127593.1.46353 WP_000127593.1.46529 WP_000127593.1.46619 WP_000127593.1.46720 WP_000127593.1.46736 WP_000127593.1.46770 WP_000127593.1.4680 WP_000127593.1.46906 WP_000127593.1.46914 WP_000127593.1.46929 WP_000127593.1.4694 WP_000127593.1.46947 WP_000127593.1.47002 WP_000127593.1.47107 WP_000127593.1.47111 WP_000127593.1.47175 WP_000127593.1.47282 WP_000127593.1.47334 WP_000127593.1.47408 WP_000127593.1.47459 WP_000127593.1.47522 WP_000127593.1.47617 WP_000127593.1.47669 WP_000127593.1.47680 WP_000127593.1.47747 WP_000127593.1.47835 WP_000127593.1.47851 WP_000127593.1.47908 WP_000127593.1.4792 WP_000127593.1.48046 WP_000127593.1.48064 WP_000127593.1.48067 WP_000127593.1.48116 WP_000127593.1.48142 WP_000127593.1.48156 WP_000127593.1.48187 WP_000127593.1.48223 WP_000127593.1.48272 WP_000127593.1.48282 WP_000127593.1.48310 WP_000127593.1.48338 WP_000127593.1.48376 WP_000127593.1.48398 WP_000127593.1.4840 WP_000127593.1.48427 WP_000127593.1.48437 WP_000127593.1.48438 WP_000127593.1.48479 WP_000127593.1.4852 WP_000127593.1.48580 WP_000127593.1.48664 WP_000127593.1.48670 WP_000127593.1.48723 WP_000127593.1.48769 WP_000127593.1.48782 WP_000127593.1.48869 WP_000127593.1.49018 WP_000127593.1.49071 WP_000127593.1.49094 WP_000127593.1.49105 WP_000127593.1.49128 WP_000127593.1.49171 WP_000127593.1.49189 WP_000127593.1.49196 WP_000127593.1.49199 WP_000127593.1.4924 WP_000127593.1.49257 WP_000127593.1.49301 WP_000127593.1.49326 WP_000127593.1.49362 WP_000127593.1.49418 WP_000127593.1.4945 WP_000127593.1.49518 WP_000127593.1.49549 WP_000127593.1.49581 WP_000127593.1.49582 WP_000127593.1.496 WP_000127593.1.49603 WP_000127593.1.49643 WP_000127593.1.49672 WP_000127593.1.49690 WP_000127593.1.49728 WP_000127593.1.49732 WP_000127593.1.49745 WP_000127593.1.49819 WP_000127593.1.49918 WP_000127593.1.49935 WP_000127593.1.50028 WP_000127593.1.50117 WP_000127593.1.50178 WP_000127593.1.50192 WP_000127593.1.50291 WP_000127593.1.50367 WP_000127593.1.50388 WP_000127593.1.5045 WP_000127593.1.50464 WP_000127593.1.50525 WP_000127593.1.50558 WP_000127593.1.50568 WP_000127593.1.5059 WP_000127593.1.50594 WP_000127593.1.50647 WP_000127593.1.50699 WP_000127593.1.50740 WP_000127593.1.50817 WP_000127593.1.50829 WP_000127593.1.5087 WP_000127593.1.50974 WP_000127593.1.51015 WP_000127593.1.51130 WP_000127593.1.51209 WP_000127593.1.51226 WP_000127593.1.51271 WP_000127593.1.51277 WP_000127593.1.51326 WP_000127593.1.51393 WP_000127593.1.51496 WP_000127593.1.51557 WP_000127593.1.51744 WP_000127593.1.51794 WP_000127593.1.51824 WP_000127593.1.51912 WP_000127593.1.52034 WP_000127593.1.52061 WP_000127593.1.52072 WP_000127593.1.52195 WP_000127593.1.52198 WP_000127593.1.52210 WP_000127593.1.52289 WP_000127593.1.52308 WP_000127593.1.52343 WP_000127593.1.52377 WP_000127593.1.52396 WP_000127593.1.52427 WP_000127593.1.52452 WP_000127593.1.5251 WP_000127593.1.52511 WP_000127593.1.52605 WP_000127593.1.52633 WP_000127593.1.52670 WP_000127593.1.52830 WP_000127593.1.52889 WP_000127593.1.52900 WP_000127593.1.52965 WP_000127593.1.52983 WP_000127593.1.5304 WP_000127593.1.53050 WP_000127593.1.53057 WP_000127593.1.5319 WP_000127593.1.53245 WP_000127593.1.53312 WP_000127593.1.53363 WP_000127593.1.53373 WP_000127593.1.53379 WP_000127593.1.53408 WP_000127593.1.53467 WP_000127593.1.5347 WP_000127593.1.53532 WP_000127593.1.53691 WP_000127593.1.53774 WP_000127593.1.53799 WP_000127593.1.53911 WP_000127593.1.53926 WP_000127593.1.54049 WP_000127593.1.54074 WP_000127593.1.54086 WP_000127593.1.54237 WP_000127593.1.54290 WP_000127593.1.54299 WP_000127593.1.54404 WP_000127593.1.54438 WP_000127593.1.54471 WP_000127593.1.54479 WP_000127593.1.54485 WP_000127593.1.54491 WP_000127593.1.54574 WP_000127593.1.54744 WP_000127593.1.54830 WP_000127593.1.54851 WP_000127593.1.54929 WP_000127593.1.54931 WP_000127593.1.54967 WP_000127593.1.54990 WP_000127593.1.5500 WP_000127593.1.55004 WP_000127593.1.55058 WP_000127593.1.55082 WP_000127593.1.55084 WP_000127593.1.55095 WP_000127593.1.55139 WP_000127593.1.5518 WP_000127593.1.552 WP_000127593.1.55239 WP_000127593.1.55271 WP_000127593.1.55327 WP_000127593.1.55336 WP_000127593.1.55419 WP_000127593.1.55495 WP_000127593.1.5550 WP_000127593.1.55527 WP_000127593.1.55535 WP_000127593.1.55603 WP_000127593.1.55719 WP_000127593.1.55724 WP_000127593.1.55845 WP_000127593.1.55955 WP_000127593.1.56003 WP_000127593.1.5604 WP_000127593.1.56064 WP_000127593.1.56106 WP_000127593.1.56135 WP_000127593.1.56159 WP_000127593.1.56200 WP_000127593.1.56220 WP_000127593.1.56237 WP_000127593.1.56265 WP_000127593.1.56387 WP_000127593.1.56464 WP_000127593.1.56482 WP_000127593.1.56527 WP_000127593.1.56542 WP_000127593.1.56608 WP_000127593.1.56619 WP_000127593.1.56702 WP_000127593.1.56708 WP_000127593.1.56737 WP_000127593.1.5675 WP_000127593.1.56767 WP_000127593.1.56779 WP_000127593.1.56822 WP_000127593.1.56903 WP_000127593.1.56931 WP_000127593.1.56966 WP_000127593.1.56975 WP_000127593.1.57015 WP_000127593.1.5705 WP_000127593.1.57081 WP_000127593.1.57115 WP_000127593.1.57141 WP_000127593.1.57330 WP_000127593.1.57427 WP_000127593.1.57448 WP_000127593.1.57593 WP_000127593.1.57670 WP_000127593.1.57693 WP_000127593.1.57701 WP_000127593.1.57718 WP_000127593.1.57727 WP_000127593.1.57745 WP_000127593.1.57783 WP_000127593.1.57844 WP_000127593.1.57962 WP_000127593.1.5799 WP_000127593.1.58006 WP_000127593.1.58051 WP_000127593.1.58122 WP_000127593.1.5817 WP_000127593.1.58185 WP_000127593.1.58198 WP_000127593.1.58241 WP_000127593.1.58246 WP_000127593.1.58325 WP_000127593.1.58350 WP_000127593.1.58353 WP_000127593.1.58366 WP_000127593.1.58373 WP_000127593.1.58392 WP_000127593.1.58421 WP_000127593.1.58481 WP_000127593.1.5849 WP_000127593.1.58508 WP_000127593.1.58521 WP_000127593.1.586 WP_000127593.1.58603 WP_000127593.1.58714 WP_000127593.1.58775 WP_000127593.1.58855 WP_000127593.1.58936 WP_000127593.1.58998 WP_000127593.1.5901 WP_000127593.1.5904 WP_000127593.1.59133 WP_000127593.1.5925 WP_000127593.1.59269 WP_000127593.1.59284 WP_000127593.1.59327 WP_000127593.1.59363 WP_000127593.1.59397 WP_000127593.1.59457 WP_000127593.1.59459 WP_000127593.1.59467 WP_000127593.1.59478 WP_000127593.1.59603 WP_000127593.1.59609 WP_000127593.1.59629 WP_000127593.1.59663 WP_000127593.1.59697 WP_000127593.1.59803 WP_000127593.1.59881 WP_000127593.1.59886 WP_000127593.1.59977 WP_000127593.1.60022 WP_000127593.1.60086 WP_000127593.1.60156 WP_000127593.1.60181 WP_000127593.1.60251 WP_000127593.1.60259 WP_000127593.1.60280 WP_000127593.1.60307 WP_000127593.1.60368 WP_000127593.1.60431 WP_000127593.1.60462 WP_000127593.1.60515 WP_000127593.1.60551 WP_000127593.1.60594 WP_000127593.1.60690 WP_000127593.1.60696 WP_000127593.1.60787 WP_000127593.1.60898 WP_000127593.1.60939 WP_000127593.1.61030 WP_000127593.1.61119 WP_000127593.1.61152 WP_000127593.1.61153 WP_000127593.1.6118 WP_000127593.1.61188 WP_000127593.1.61257 WP_000127593.1.61324 WP_000127593.1.61339 WP_000127593.1.61408 WP_000127593.1.61413 WP_000127593.1.61421 WP_000127593.1.61547 WP_000127593.1.61591 WP_000127593.1.6168 WP_000127593.1.61784 WP_000127593.1.61831 WP_000127593.1.61910 WP_000127593.1.61970 WP_000127593.1.62030 WP_000127593.1.62093 WP_000127593.1.62140 WP_000127593.1.62164 WP_000127593.1.62367 WP_000127593.1.62409 WP_000127593.1.62459 WP_000127593.1.62539 WP_000127593.1.62575 WP_000127593.1.62630 WP_000127593.1.62685 WP_000127593.1.62740 WP_000127593.1.62756 WP_000127593.1.62781 WP_000127593.1.62796 WP_000127593.1.62808 WP_000127593.1.62829 WP_000127593.1.62842 WP_000127593.1.62878 WP_000127593.1.62956 WP_000127593.1.63011 WP_000127593.1.63050 WP_000127593.1.631 WP_000127593.1.63132 WP_000127593.1.63182 WP_000127593.1.63195 WP_000127593.1.63233 WP_000127593.1.63244 WP_000127593.1.63273 WP_000127593.1.63279 WP_000127593.1.63296 WP_000127593.1.63307 WP_000127593.1.63319 WP_000127593.1.63324 WP_000127593.1.63335 WP_000127593.1.63337 WP_000127593.1.63383 WP_000127593.1.63406 WP_000127593.1.63411 WP_000127593.1.63421 WP_000127593.1.63460 WP_000127593.1.63510 WP_000127593.1.63527 WP_000127593.1.63565 WP_000127593.1.63617 WP_000127593.1.63693 WP_000127593.1.63705 WP_000127593.1.6378 WP_000127593.1.63847 WP_000127593.1.63894 WP_000127593.1.64012 WP_000127593.1.64094 WP_000127593.1.64108 WP_000127593.1.64207 WP_000127593.1.64251 WP_000127593.1.64303 WP_000127593.1.64368 WP_000127593.1.64628 WP_000127593.1.64643 WP_000127593.1.64665 WP_000127593.1.64811 WP_000127593.1.64845 WP_000127593.1.64860 WP_000127593.1.64951 WP_000127593.1.64956 WP_000127593.1.64996 WP_000127593.1.65025 WP_000127593.1.65038 WP_000127593.1.65076 WP_000127593.1.65233 WP_000127593.1.65264 WP_000127593.1.65358 WP_000127593.1.65387 WP_000127593.1.65406 WP_000127593.1.65407 WP_000127593.1.6544 WP_000127593.1.65448 WP_000127593.1.65585 WP_000127593.1.65616 WP_000127593.1.65629 WP_000127593.1.65643 WP_000127593.1.65656 WP_000127593.1.6568 WP_000127593.1.65713 WP_000127593.1.65734 WP_000127593.1.65769 WP_000127593.1.65809 WP_000127593.1.6585 WP_000127593.1.65892 WP_000127593.1.65935 WP_000127593.1.65947 WP_000127593.1.65965 WP_000127593.1.6603 WP_000127593.1.66054 WP_000127593.1.66069 WP_000127593.1.66073 WP_000127593.1.66130 WP_000127593.1.66144 WP_000127593.1.66265 WP_000127593.1.66298 WP_000127593.1.6632 WP_000127593.1.66366 WP_000127593.1.66453 WP_000127593.1.66513 WP_000127593.1.66556 WP_000127593.1.66598 WP_000127593.1.66611 WP_000127593.1.66614 WP_000127593.1.6662 WP_000127593.1.66705 WP_000127593.1.66756 WP_000127593.1.66766 WP_000127593.1.66803 WP_000127593.1.66816 WP_000127593.1.66879 WP_000127593.1.6688 WP_000127593.1.66938 WP_000127593.1.66969 WP_000127593.1.67012 WP_000127593.1.67014 WP_000127593.1.67067 WP_000127593.1.67072 WP_000127593.1.67113 WP_000127593.1.67155 WP_000127593.1.67160 WP_000127593.1.67238 WP_000127593.1.67251 WP_000127593.1.67259 WP_000127593.1.6726 WP_000127593.1.67286 WP_000127593.1.67294 WP_000127593.1.67312 WP_000127593.1.67328 WP_000127593.1.67418 WP_000127593.1.67420 WP_000127593.1.67425 WP_000127593.1.67457 WP_000127593.1.67460 WP_000127593.1.67540 WP_000127593.1.67571 WP_000127593.1.67621 WP_000127593.1.67644 WP_000127593.1.67653 WP_000127593.1.67691 WP_000127593.1.67806 WP_000127593.1.67834 WP_000127593.1.67867 WP_000127593.1.67880 WP_000127593.1.67900 WP_000127593.1.67991 WP_000127593.1.68101 WP_000127593.1.68134 WP_000127593.1.68141 WP_000127593.1.68152 WP_000127593.1.68202 WP_000127593.1.68221 WP_000127593.1.68223 WP_000127593.1.6824 WP_000127593.1.68268 WP_000127593.1.68296 WP_000127593.1.68299 WP_000127593.1.68355 WP_000127593.1.68366 WP_000127593.1.68398 WP_000127593.1.68399 WP_000127593.1.68476 WP_000127593.1.68479 WP_000127593.1.68504 WP_000127593.1.68512 WP_000127593.1.68548 WP_000127593.1.686 WP_000127593.1.68636 WP_000127593.1.68681 WP_000127593.1.68683 WP_000127593.1.68741 WP_000127593.1.68743 WP_000127593.1.68864 WP_000127593.1.68883 WP_000127593.1.69012 WP_000127593.1.69071 WP_000127593.1.69078 WP_000127593.1.691 WP_000127593.1.69105 WP_000127593.1.6915 WP_000127593.1.69198 WP_000127593.1.69213 WP_000127593.1.69349 WP_000127593.1.69394 WP_000127593.1.69437 WP_000127593.1.69475 WP_000127593.1.69490 WP_000127593.1.6953 WP_000127593.1.69546 WP_000127593.1.69598 WP_000127593.1.6968 WP_000127593.1.69683 WP_000127593.1.69724 WP_000127593.1.69734 WP_000127593.1.6980 WP_000127593.1.69820 WP_000127593.1.69823 WP_000127593.1.69830 WP_000127593.1.69882 WP_000127593.1.699 WP_000127593.1.69902 WP_000127593.1.69934 WP_000127593.1.69980 WP_000127593.1.69995 WP_000127593.1.70059 WP_000127593.1.70161 WP_000127593.1.70210 WP_000127593.1.70220 WP_000127593.1.70225 WP_000127593.1.70228 WP_000127593.1.70294 WP_000127593.1.70311 WP_000127593.1.70313 WP_000127593.1.70334 WP_000127593.1.70448 WP_000127593.1.7046 WP_000127593.1.70487 WP_000127593.1.70495 WP_000127593.1.70527 WP_000127593.1.70554 WP_000127593.1.70558 WP_000127593.1.70564 WP_000127593.1.7064 WP_000127593.1.70664 WP_000127593.1.707 WP_000127593.1.70721 WP_000127593.1.70763 WP_000127593.1.70808 WP_000127593.1.70835 WP_000127593.1.70843 WP_000127593.1.70909 WP_000127593.1.70926 WP_000127593.1.710 WP_000127593.1.71016 WP_000127593.1.7105 WP_000127593.1.71208 WP_000127593.1.71231 WP_000127593.1.71267 WP_000127593.1.71313 WP_000127593.1.71410 WP_000127593.1.71467 WP_000127593.1.71475 WP_000127593.1.71715 WP_000127593.1.71721 WP_000127593.1.71737 WP_000127593.1.71739 WP_000127593.1.71741 WP_000127593.1.71863 WP_000127593.1.71877 WP_000127593.1.71892 WP_000127593.1.71899 WP_000127593.1.71910 WP_000127593.1.71978 WP_000127593.1.72002 WP_000127593.1.72018 WP_000127593.1.72085 WP_000127593.1.72148 WP_000127593.1.722 WP_000127593.1.72204 WP_000127593.1.72306 WP_000127593.1.72340 WP_000127593.1.72363 WP_000127593.1.72371 WP_000127593.1.72453 WP_000127593.1.72465 WP_000127593.1.72497 WP_000127593.1.7254 WP_000127593.1.7258 WP_000127593.1.7260 WP_000127593.1.72649 WP_000127593.1.72666 WP_000127593.1.72708 WP_000127593.1.72719 WP_000127593.1.72753 WP_000127593.1.72762 WP_000127593.1.72881 WP_000127593.1.72930 WP_000127593.1.72961 WP_000127593.1.72991 WP_000127593.1.73002 WP_000127593.1.73021 WP_000127593.1.73087 WP_000127593.1.73140 WP_000127593.1.73190 WP_000127593.1.73195 WP_000127593.1.73201 WP_000127593.1.73211 WP_000127593.1.73240 WP_000127593.1.73241 WP_000127593.1.73264 WP_000127593.1.73401 WP_000127593.1.73420 WP_000127593.1.73450 WP_000127593.1.73464 WP_000127593.1.73513 WP_000127593.1.73539 WP_000127593.1.7360 WP_000127593.1.73610 WP_000127593.1.7365 WP_000127593.1.73674 WP_000127593.1.73694 WP_000127593.1.73740 WP_000127593.1.73789 WP_000127593.1.73885 WP_000127593.1.73900 WP_000127593.1.73921 WP_000127593.1.73940 WP_000127593.1.73949 WP_000127593.1.73971 WP_000127593.1.74004 WP_000127593.1.7401 WP_000127593.1.7406 WP_000127593.1.74073 WP_000127593.1.74085 WP_000127593.1.74172 WP_000127593.1.74257 WP_000127593.1.74284 WP_000127593.1.74295 WP_000127593.1.74327 WP_000127593.1.74456 WP_000127593.1.74468 WP_000127593.1.74576 WP_000127593.1.74676 WP_000127593.1.74681 WP_000127593.1.74758 WP_000127593.1.74770 WP_000127593.1.74785 WP_000127593.1.74797 WP_000127593.1.7482 WP_000127593.1.74874 WP_000127593.1.74924 WP_000127593.1.75070 WP_000127593.1.75093 WP_000127593.1.75111 WP_000127593.1.75131 WP_000127593.1.75132 WP_000127593.1.75141 WP_000127593.1.75323 WP_000127593.1.75351 WP_000127593.1.75356 WP_000127593.1.75409 WP_000127593.1.75538 WP_000127593.1.75566 WP_000127593.1.75571 WP_000127593.1.75647 WP_000127593.1.75692 WP_000127593.1.75728 WP_000127593.1.75743 WP_000127593.1.75800 WP_000127593.1.75809 WP_000127593.1.75840 WP_000127593.1.75862 WP_000127593.1.75910 WP_000127593.1.76013 WP_000127593.1.7602 WP_000127593.1.76047 WP_000127593.1.76049 WP_000127593.1.76050 WP_000127593.1.76053 WP_000127593.1.76111 WP_000127593.1.76114 WP_000127593.1.76121 WP_000127593.1.76153 WP_000127593.1.76179 WP_000127593.1.7627 WP_000127593.1.76313 WP_000127593.1.76424 WP_000127593.1.76426 WP_000127593.1.76431 WP_000127593.1.76463 WP_000127593.1.76497 WP_000127593.1.76674 WP_000127593.1.76711 WP_000127593.1.76718 WP_000127593.1.76798 WP_000127593.1.76803 WP_000127593.1.76829 WP_000127593.1.7694 WP_000127593.1.77043 WP_000127593.1.77072 WP_000127593.1.77137 WP_000127593.1.77158 WP_000127593.1.77187 WP_000127593.1.77190 WP_000127593.1.77203 WP_000127593.1.77229 WP_000127593.1.77297 WP_000127593.1.77298 WP_000127593.1.77331 WP_000127593.1.77346 WP_000127593.1.77359 WP_000127593.1.77388 WP_000127593.1.77498 WP_000127593.1.7752 WP_000127593.1.77532 WP_000127593.1.77650 WP_000127593.1.77735 WP_000127593.1.77791 WP_000127593.1.7785 WP_000127593.1.7786 WP_000127593.1.77882 WP_000127593.1.77893 WP_000127593.1.77915 WP_000127593.1.77922 WP_000127593.1.77930 WP_000127593.1.77986 WP_000127593.1.78038 WP_000127593.1.78082 WP_000127593.1.78093 WP_000127593.1.7810 WP_000127593.1.78164 WP_000127593.1.78179 WP_000127593.1.78194 WP_000127593.1.78208 WP_000127593.1.78304 WP_000127593.1.78330 WP_000127593.1.78335 WP_000127593.1.78371 WP_000127593.1.78434 WP_000127593.1.78436 WP_000127593.1.78470 WP_000127593.1.78489 WP_000127593.1.78494 WP_000127593.1.7853 WP_000127593.1.78573 WP_000127593.1.78585 WP_000127593.1.78592 WP_000127593.1.78662 WP_000127593.1.78685 WP_000127593.1.78736 WP_000127593.1.78758 WP_000127593.1.78763 WP_000127593.1.78816 WP_000127593.1.78920 WP_000127593.1.78937 WP_000127593.1.78991 WP_000127593.1.78995 WP_000127593.1.7905 WP_000127593.1.79110 WP_000127593.1.7914 WP_000127593.1.79143 WP_000127593.1.79178 WP_000127593.1.79192 WP_000127593.1.79275 WP_000127593.1.79285 WP_000127593.1.79378 WP_000127593.1.79552 WP_000127593.1.79581 WP_000127593.1.79627 WP_000127593.1.79677 WP_000127593.1.79731 WP_000127593.1.79763 WP_000127593.1.7981 WP_000127593.1.79815 WP_000127593.1.79904 WP_000127593.1.79949 WP_000127593.1.80009 WP_000127593.1.80013 WP_000127593.1.80029 WP_000127593.1.80086 WP_000127593.1.80119 WP_000127593.1.80120 WP_000127593.1.80122 WP_000127593.1.80146 WP_000127593.1.80178 WP_000127593.1.80184 WP_000127593.1.80244 WP_000127593.1.80274 WP_000127593.1.80316 WP_000127593.1.80361 WP_000127593.1.80389 WP_000127593.1.8040 WP_000127593.1.80434 WP_000127593.1.8045 WP_000127593.1.80521 WP_000127593.1.80582 WP_000127593.1.80745 WP_000127593.1.80899 WP_000127593.1.81022 WP_000127593.1.81049 WP_000127593.1.81052 WP_000127593.1.81095 WP_000127593.1.81151 WP_000127593.1.81172 WP_000127593.1.81176 WP_000127593.1.81184 WP_000127593.1.81214 WP_000127593.1.81228 WP_000127593.1.81232 WP_000127593.1.81288 WP_000127593.1.81290 WP_000127593.1.81379 WP_000127593.1.81508 WP_000127593.1.81574 WP_000127593.1.8160 WP_000127593.1.81604 WP_000127593.1.81619 WP_000127593.1.81645 WP_000127593.1.8180 WP_000127593.1.81837 WP_000127593.1.81838 WP_000127593.1.8185 WP_000127593.1.81969 WP_000127593.1.81990 WP_000127593.1.8206 WP_000127593.1.82103 WP_000127593.1.8213 WP_000127593.1.82174 WP_000127593.1.82184 WP_000127593.1.82253 WP_000127593.1.82281 WP_000127593.1.82301 WP_000127593.1.82349 WP_000127593.1.82406 WP_000127593.1.82458 WP_000127593.1.82468 WP_000127593.1.82525 WP_000127593.1.82535 WP_000127593.1.82558 WP_000127593.1.8266 WP_000127593.1.82678 WP_000127593.1.82768 WP_000127593.1.82824 WP_000127593.1.82855 WP_000127593.1.82930 WP_000127593.1.82941 WP_000127593.1.83046 WP_000127593.1.83054 WP_000127593.1.83078 WP_000127593.1.83086 WP_000127593.1.83103 WP_000127593.1.8318 WP_000127593.1.83203 WP_000127593.1.83291 WP_000127593.1.83359 WP_000127593.1.83405 WP_000127593.1.83417 WP_000127593.1.8346 WP_000127593.1.83467 WP_000127593.1.83472 WP_000127593.1.83479 WP_000127593.1.83520 WP_000127593.1.83553 WP_000127593.1.8366 WP_000127593.1.83674 WP_000127593.1.83728 WP_000127593.1.83750 WP_000127593.1.83756 WP_000127593.1.83758 WP_000127593.1.83788 WP_000127593.1.83797 WP_000127593.1.83844 WP_000127593.1.8385 WP_000127593.1.83886 WP_000127593.1.83905 WP_000127593.1.83989 WP_000127593.1.84025 WP_000127593.1.84054 WP_000127593.1.84118 WP_000127593.1.84129 WP_000127593.1.84161 WP_000127593.1.84188 WP_000127593.1.84275 WP_000127593.1.84415 WP_000127593.1.84418 WP_000127593.1.84590 WP_000127593.1.84596 WP_000127593.1.84608 WP_000127593.1.8462 WP_000127593.1.84648 WP_000127593.1.84651 WP_000127593.1.84696 WP_000127593.1.84826 WP_000127593.1.84847 WP_000127593.1.84854 WP_000127593.1.84924 WP_000127593.1.8496 WP_000127593.1.84978 WP_000127593.1.85017 WP_000127593.1.85026 WP_000127593.1.85045 WP_000127593.1.85070 WP_000127593.1.85118 WP_000127593.1.85229 WP_000127593.1.85289 WP_000127593.1.85375 WP_000127593.1.85376 WP_000127593.1.85409 WP_000127593.1.85441 WP_000127593.1.85485 WP_000127593.1.85585 WP_000127593.1.85596 WP_000127593.1.85611 WP_000127593.1.85730 WP_000127593.1.85732 WP_000127593.1.85858 WP_000127593.1.85906 WP_000127593.1.85924 WP_000127593.1.85971 WP_000127593.1.85980 WP_000127593.1.85989 WP_000127593.1.86036 WP_000127593.1.86042 WP_000127593.1.86086 WP_000127593.1.862 WP_000127593.1.86209 WP_000127593.1.86281 WP_000127593.1.86315 WP_000127593.1.8636 WP_000127593.1.86363 WP_000127593.1.86390 WP_000127593.1.86473 WP_000127593.1.86531 WP_000127593.1.86664 WP_000127593.1.86704 WP_000127593.1.86736 WP_000127593.1.86745 WP_000127593.1.86779 WP_000127593.1.86793 WP_000127593.1.86795 WP_000127593.1.8690 WP_000127593.1.86968 WP_000127593.1.86999 WP_000127593.1.87088 WP_000127593.1.87097 WP_000127593.1.87100 WP_000127593.1.87133 WP_000127593.1.87137 WP_000127593.1.87168 WP_000127593.1.87190 WP_000127593.1.87204 WP_000127593.1.87221 WP_000127593.1.87296 WP_000127593.1.87363 WP_000127593.1.87372 WP_000127593.1.87388 WP_000127593.1.87511 WP_000127593.1.87541 WP_000127593.1.87595 WP_000127593.1.8764 WP_000127593.1.87734 WP_000127593.1.87745 WP_000127593.1.87838 WP_000127593.1.87841 WP_000127593.1.87854 WP_000127593.1.87865 WP_000127593.1.8791 WP_000127593.1.87937 WP_000127593.1.87964 WP_000127593.1.87967 WP_000127593.1.88169 WP_000127593.1.88309 WP_000127593.1.88375 WP_000127593.1.88418 WP_000127593.1.88430 WP_000127593.1.88440 WP_000127593.1.88449 WP_000127593.1.8847 WP_000127593.1.88555 WP_000127593.1.88563 WP_000127593.1.88585 WP_000127593.1.8859 WP_000127593.1.88600 WP_000127593.1.88614 WP_000127593.1.88696 WP_000127593.1.88771 WP_000127593.1.88781 WP_000127593.1.88843 WP_000127593.1.8886 WP_000127593.1.88878 WP_000127593.1.88897 WP_000127593.1.88954 WP_000127593.1.88960 WP_000127593.1.88962 WP_000127593.1.89012 WP_000127593.1.89024 WP_000127593.1.89036 WP_000127593.1.89125 WP_000127593.1.89164 WP_000127593.1.8918 WP_000127593.1.89184 WP_000127593.1.89262 WP_000127593.1.89290 WP_000127593.1.89348 WP_000127593.1.89350 WP_000127593.1.89390 WP_000127593.1.89404 WP_000127593.1.89433 WP_000127593.1.89779 WP_000127593.1.89794 WP_000127593.1.898 WP_000127593.1.89863 WP_000127593.1.89908 WP_000127593.1.89949 WP_000127593.1.89950 WP_000127593.1.90069 WP_000127593.1.90173 WP_000127593.1.90174 WP_000127593.1.90217 WP_000127593.1.90250 WP_000127593.1.90386 WP_000127593.1.90447 WP_000127593.1.90454 WP_000127593.1.90475 WP_000127593.1.90488 WP_000127593.1.90506 WP_000127593.1.90533 WP_000127593.1.90556 WP_000127593.1.90661 WP_000127593.1.90698 WP_000127593.1.9076 WP_000127593.1.91005 WP_000127593.1.91019 WP_000127593.1.91150 WP_000127593.1.9122 WP_000127593.1.91280 WP_000127593.1.91287 WP_000127593.1.91371 WP_000127593.1.91447 WP_000127593.1.91486 WP_000127593.1.91525 WP_000127593.1.91530 WP_000127593.1.9155 WP_000127593.1.91586 WP_000127593.1.91611 WP_000127593.1.91634 WP_000127593.1.91670 WP_000127593.1.917 WP_000127593.1.91704 WP_000127593.1.91745 WP_000127593.1.91848 WP_000127593.1.91918 WP_000127593.1.91969 WP_000127593.1.92080 WP_000127593.1.92125 WP_000127593.1.92143 WP_000127593.1.92186 WP_000127593.1.92212 WP_000127593.1.92228 WP_000127593.1.92244 WP_000127593.1.92249 WP_000127593.1.92254 WP_000127593.1.923 WP_000127593.1.92303 WP_000127593.1.92391 WP_000127593.1.92405 WP_000127593.1.92425 WP_000127593.1.9247 WP_000127593.1.92512 WP_000127593.1.92667 WP_000127593.1.92674 WP_000127593.1.92718 WP_000127593.1.92765 WP_000127593.1.92795 WP_000127593.1.9286 WP_000127593.1.9296 WP_000127593.1.92965 WP_000127593.1.92997 WP_000127593.1.93047 WP_000127593.1.93071 WP_000127593.1.93147 WP_000127593.1.93197 WP_000127593.1.93211 WP_000127593.1.93243 WP_000127593.1.93254 WP_000127593.1.93260 WP_000127593.1.93296 WP_000127593.1.93378 WP_000127593.1.93471 WP_000127593.1.93567 WP_000127593.1.93579 WP_000127593.1.93708 WP_000127593.1.93758 WP_000127593.1.93762 WP_000127593.1.93775 WP_000127593.1.93890 WP_000127593.1.94 WP_000127593.1.94053 WP_000127593.1.94080 WP_000127593.1.94122 WP_000127593.1.94123 WP_000127593.1.94130 WP_000127593.1.94242 WP_000127593.1.94245 WP_000127593.1.94248 WP_000127593.1.94268 WP_000127593.1.94287 WP_000127593.1.9430 WP_000127593.1.94320 WP_000127593.1.94324 WP_000127593.1.94337 WP_000127593.1.94341 WP_000127593.1.94484 WP_000127593.1.94505 WP_000127593.1.94536 WP_000127593.1.9455 WP_000127593.1.94825 WP_000127593.1.94969 WP_000127593.1.95008 WP_000127593.1.95023 WP_000127593.1.95029 WP_000127593.1.95033 WP_000127593.1.95075 WP_000127593.1.95156 WP_000127593.1.95193 WP_000127593.1.95263 WP_000127593.1.95281 WP_000127593.1.95294 WP_000127593.1.95318 WP_000127593.1.95386 WP_000127593.1.95415 WP_000127593.1.95494 WP_000127593.1.95512 WP_000127593.1.95519 WP_000127593.1.95522 WP_000127593.1.95550 WP_000127593.1.95560 WP_000127593.1.9563 WP_000127593.1.95683 WP_000127593.1.95780 WP_000127593.1.95804 WP_000127593.1.95832 WP_000127593.1.959 WP_000127593.1.95962 WP_000127593.1.96160 WP_000127593.1.96163 WP_000127593.1.9617 WP_000127593.1.96209 WP_000127593.1.96218 WP_000127593.1.96305 WP_000127593.1.96316 WP_000127593.1.96468 WP_000127593.1.96568 WP_000127593.1.96646 WP_000127593.1.96688 WP_000127593.1.96727 WP_000127593.1.96770 WP_000127593.1.96804 WP_000127593.1.96895 WP_000127593.1.96918 WP_000127593.1.9695 WP_000127593.1.96976 WP_000127593.1.97001 WP_000127593.1.97007 WP_000127593.1.97072 WP_000127593.1.97117 WP_000127593.1.97138 WP_000127593.1.97191 WP_000127593.1.97267 WP_000127593.1.97295 WP_000127593.1.97411 WP_000127593.1.9743 WP_000127593.1.97536 WP_000127593.1.97574 WP_000127593.1.97627 WP_000127593.1.97729 WP_000127593.1.97731 WP_000127593.1.97739 WP_000127593.1.97758 WP_000127593.1.97786 WP_000127593.1.97827 WP_000127593.1.97835 WP_000127593.1.9789 WP_000127593.1.97899 WP_000127593.1.97928 WP_000127593.1.97967 WP_000127593.1.97999 WP_000127593.1.98011 WP_000127593.1.98033 WP_000127593.1.98051 WP_000127593.1.98242 WP_000127593.1.98361 WP_000127593.1.98379 WP_000127593.1.98411 WP_000127593.1.98456 WP_000127593.1.98512 WP_000127593.1.98552 WP_000127593.1.986 WP_000127593.1.98655 WP_000127593.1.98706 WP_000127593.1.98767 WP_000127593.1.98837 WP_000127593.1.98858 WP_000127593.1.98874 WP_000127593.1.98967 WP_000127593.1.99009 WP_000127593.1.99025 WP_000127593.1.99155 WP_000127593.1.99171 WP_000127593.1.99217 WP_000127593.1.99249 WP_000127593.1.99280 WP_000127593.1.99359 WP_000127593.1.9936 WP_000127593.1.99405 WP_000127593.1.99430 WP_000127593.1.99459 WP_000127593.1.99492 WP_000127593.1.99494 WP_000127593.1.99519 WP_000127593.1.99536 WP_000127593.1.99538 WP_000127593.1.99564 WP_000127593.1.99569 WP_000127593.1.9960 WP_000127593.1.99631 WP_000127593.1.99638 WP_000127593.1.99686 WP_000127593.1.99759 WP_000127593.1.99802 WP_000127593.1.99850 WP_000127593.1.99860 WP_000127593.1.9987 WP_000127593.1.99926 WP_000127593.1.99956 WP_000127593.1.99979 WP_000127593.1.99985 YP_499927.1.76163 gi|88195126|ref|YP_499927.1| gi|554644203|ref|YP_008715994.1| gi|379014606|ref|YP_005290842.1| IDP00718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]