SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161509566|ref|YP_001575225.1| from Staphylococcus aureus subsp. aureus USA300_TCH1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161509566|ref|YP_001575225.1|
Domain Number 1 Region: 26-288
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.44e-75
Family Alanine racemase-like, N-terminal domain 0.00000494
Further Details:      
 
Domain Number 2 Region: 263-419
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.35e-46
Family Eukaryotic ODC-like 0.0000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161509566|ref|YP_001575225.1|
Sequence length 421
Comment diaminopimelate decarboxylase [Staphylococcus aureus subsp. aureus USA300_TCH1516]
Sequence
MTVKYNQNGELTMDGISLKTIAQSFGTPTIVYDELQIREQMRRYHRAFKDSGLKYNISYA
SKAFTCIQMVKLVAEEDLQLDVVSEGELYTALEAGFEPSRIHFHGNNKTKHEIRYALENN
IGYFVIDSLEEIELIDRYANDTVQVVLRVNPGVEAHTHEFIQTGQEDSKFGLSIQYGLAK
KAIDKVQQSKHLKLKGVHCHIGSQIEGTEAFIETAKIVLRWLKEQGIQVELLNLGGGFGI
KYVEGDESFPIESGIKDITDAIKSEIKVLGIDAPEIGIEPGRSIVGEAGVTLYEVGTIKE
IPEINKYVSIDGGMSDHIRTALYDAKYQALLVNRNEEADDSVTIAGKLCESGDIIIKDAK
LPSSVKRGDYLAILSTGAYHYSMASNYNQMQKPSVFFLKDGKAREVIKRQSLRQLIINDT
K
Download sequence
Identical sequences A0A0E1AGK1 A0A0E1VJM0 A0A0H2XFD9 A0A0H3JRG1 A0A0H3JU40 A0A0H3JXA0 A0A1E8XDU4 A0A2K4E2N0 Q2FYN4 Q5HG20 Q9EV35
gi|88195127|ref|YP_499928.1| 158878.SAV1400 158879.SA1232 196620.MW1288 282459.SAS1341 359786.SaurJH9_1461 359787.SaurJH1_1490 418127.SAHV_1388 451515.SAUSA300_1293 451516.USA300HOU_1335 93061.SAOUHSC_01401 93062.SACOL1435 gi|87160810|ref|YP_493990.1| gi|150393951|ref|YP_001316626.1| NYSGXRC-T134 gi|387143012|ref|YP_005731405.1| gi|15924390|ref|NP_371924.1| gi|161509566|ref|YP_001575225.1| gi|384869941|ref|YP_005752655.1| gi|15926980|ref|NP_374513.1| gi|384864628|ref|YP_005749987.1| gi|156979719|ref|YP_001441978.1| gi|49486241|ref|YP_043462.1| gi|384862000|ref|YP_005744720.1| gi|554644204|ref|YP_008715995.1| gi|385781626|ref|YP_005757797.1| WP_000216946.1.100013 WP_000216946.1.100041 WP_000216946.1.100049 WP_000216946.1.100057 WP_000216946.1.10006 WP_000216946.1.100067 WP_000216946.1.100072 WP_000216946.1.100088 WP_000216946.1.100090 WP_000216946.1.100094 WP_000216946.1.10014 WP_000216946.1.100154 WP_000216946.1.100171 WP_000216946.1.100180 WP_000216946.1.100184 WP_000216946.1.100189 WP_000216946.1.100235 WP_000216946.1.100298 WP_000216946.1.100307 WP_000216946.1.100310 WP_000216946.1.10032 WP_000216946.1.100335 WP_000216946.1.100352 WP_000216946.1.100357 WP_000216946.1.100366 WP_000216946.1.100391 WP_000216946.1.100399 WP_000216946.1.10041 WP_000216946.1.10046 WP_000216946.1.100464 WP_000216946.1.10050 WP_000216946.1.100535 WP_000216946.1.100562 WP_000216946.1.100582 WP_000216946.1.100596 WP_000216946.1.100612 WP_000216946.1.100618 WP_000216946.1.100631 WP_000216946.1.100647 WP_000216946.1.100665 WP_000216946.1.100693 WP_000216946.1.100699 WP_000216946.1.100704 WP_000216946.1.100719 WP_000216946.1.100761 WP_000216946.1.100768 WP_000216946.1.100823 WP_000216946.1.100832 WP_000216946.1.100834 WP_000216946.1.100860 WP_000216946.1.100888 WP_000216946.1.100903 WP_000216946.1.100920 WP_000216946.1.100922 WP_000216946.1.100934 WP_000216946.1.100963 WP_000216946.1.100981 WP_000216946.1.101002 WP_000216946.1.101017 WP_000216946.1.101019 WP_000216946.1.101027 WP_000216946.1.101068 WP_000216946.1.101071 WP_000216946.1.101072 WP_000216946.1.101103 WP_000216946.1.10111 WP_000216946.1.101160 WP_000216946.1.101177 WP_000216946.1.101192 WP_000216946.1.101240 WP_000216946.1.101262 WP_000216946.1.101266 WP_000216946.1.101327 WP_000216946.1.101329 WP_000216946.1.101330 WP_000216946.1.101375 WP_000216946.1.101379 WP_000216946.1.101393 WP_000216946.1.101406 WP_000216946.1.101414 WP_000216946.1.101440 WP_000216946.1.101441 WP_000216946.1.10148 WP_000216946.1.101490 WP_000216946.1.101505 WP_000216946.1.101511 WP_000216946.1.101566 WP_000216946.1.101567 WP_000216946.1.101570 WP_000216946.1.101598 WP_000216946.1.101615 WP_000216946.1.101617 WP_000216946.1.10165 WP_000216946.1.10166 WP_000216946.1.101661 WP_000216946.1.101691 WP_000216946.1.101704 WP_000216946.1.101725 WP_000216946.1.101728 WP_000216946.1.101745 WP_000216946.1.101757 WP_000216946.1.101778 WP_000216946.1.101788 WP_000216946.1.101813 WP_000216946.1.101820 WP_000216946.1.101825 WP_000216946.1.101852 WP_000216946.1.101902 WP_000216946.1.101906 WP_000216946.1.101943 WP_000216946.1.101950 WP_000216946.1.102065 WP_000216946.1.102066 WP_000216946.1.102070 WP_000216946.1.102096 WP_000216946.1.102123 WP_000216946.1.102130 WP_000216946.1.102132 WP_000216946.1.1022 WP_000216946.1.10232 WP_000216946.1.10238 WP_000216946.1.10274 WP_000216946.1.1031 WP_000216946.1.10343 WP_000216946.1.1043 WP_000216946.1.10431 WP_000216946.1.10436 WP_000216946.1.10478 WP_000216946.1.10481 WP_000216946.1.10486 WP_000216946.1.10503 WP_000216946.1.1052 WP_000216946.1.10526 WP_000216946.1.10542 WP_000216946.1.10543 WP_000216946.1.10565 WP_000216946.1.10583 WP_000216946.1.10614 WP_000216946.1.10624 WP_000216946.1.10679 WP_000216946.1.10726 WP_000216946.1.10742 WP_000216946.1.10749 WP_000216946.1.10751 WP_000216946.1.1077 WP_000216946.1.10823 WP_000216946.1.10858 WP_000216946.1.1087 WP_000216946.1.10919 WP_000216946.1.10942 WP_000216946.1.10950 WP_000216946.1.10976 WP_000216946.1.10979 WP_000216946.1.10985 WP_000216946.1.11001 WP_000216946.1.11069 WP_000216946.1.11073 WP_000216946.1.11083 WP_000216946.1.11084 WP_000216946.1.11129 WP_000216946.1.1115 WP_000216946.1.11162 WP_000216946.1.1120 WP_000216946.1.11220 WP_000216946.1.11228 WP_000216946.1.11261 WP_000216946.1.11282 WP_000216946.1.11286 WP_000216946.1.11287 WP_000216946.1.11294 WP_000216946.1.11322 WP_000216946.1.11333 WP_000216946.1.11348 WP_000216946.1.11353 WP_000216946.1.1136 WP_000216946.1.11377 WP_000216946.1.11378 WP_000216946.1.11403 WP_000216946.1.11407 WP_000216946.1.11447 WP_000216946.1.11451 WP_000216946.1.1147 WP_000216946.1.11488 WP_000216946.1.11492 WP_000216946.1.11504 WP_000216946.1.11513 WP_000216946.1.11525 WP_000216946.1.11556 WP_000216946.1.11558 WP_000216946.1.11571 WP_000216946.1.11592 WP_000216946.1.11611 WP_000216946.1.11640 WP_000216946.1.11646 WP_000216946.1.11663 WP_000216946.1.11665 WP_000216946.1.11692 WP_000216946.1.117 WP_000216946.1.1171 WP_000216946.1.11719 WP_000216946.1.11720 WP_000216946.1.11730 WP_000216946.1.11736 WP_000216946.1.11768 WP_000216946.1.11794 WP_000216946.1.11795 WP_000216946.1.11816 WP_000216946.1.11829 WP_000216946.1.11837 WP_000216946.1.11884 WP_000216946.1.11903 WP_000216946.1.11991 WP_000216946.1.12005 WP_000216946.1.12019 WP_000216946.1.12042 WP_000216946.1.1205 WP_000216946.1.12073 WP_000216946.1.12098 WP_000216946.1.1210 WP_000216946.1.12123 WP_000216946.1.12149 WP_000216946.1.12152 WP_000216946.1.12170 WP_000216946.1.12175 WP_000216946.1.12179 WP_000216946.1.12181 WP_000216946.1.12226 WP_000216946.1.12233 WP_000216946.1.12234 WP_000216946.1.12256 WP_000216946.1.12297 WP_000216946.1.12328 WP_000216946.1.12330 WP_000216946.1.12361 WP_000216946.1.12366 WP_000216946.1.12391 WP_000216946.1.12436 WP_000216946.1.12437 WP_000216946.1.12447 WP_000216946.1.12498 WP_000216946.1.12508 WP_000216946.1.1257 WP_000216946.1.12598 WP_000216946.1.12608 WP_000216946.1.12618 WP_000216946.1.12639 WP_000216946.1.12685 WP_000216946.1.12715 WP_000216946.1.12733 WP_000216946.1.12737 WP_000216946.1.12770 WP_000216946.1.12771 WP_000216946.1.12780 WP_000216946.1.12788 WP_000216946.1.12822 WP_000216946.1.12829 WP_000216946.1.12833 WP_000216946.1.12845 WP_000216946.1.12858 WP_000216946.1.12862 WP_000216946.1.12884 WP_000216946.1.12903 WP_000216946.1.12904 WP_000216946.1.12918 WP_000216946.1.12920 WP_000216946.1.12937 WP_000216946.1.12938 WP_000216946.1.13013 WP_000216946.1.13039 WP_000216946.1.13062 WP_000216946.1.13072 WP_000216946.1.13091 WP_000216946.1.13104 WP_000216946.1.13154 WP_000216946.1.13169 WP_000216946.1.13243 WP_000216946.1.13250 WP_000216946.1.13303 WP_000216946.1.13322 WP_000216946.1.13326 WP_000216946.1.13355 WP_000216946.1.13379 WP_000216946.1.13405 WP_000216946.1.13448 WP_000216946.1.13468 WP_000216946.1.1347 WP_000216946.1.13486 WP_000216946.1.13514 WP_000216946.1.13531 WP_000216946.1.1355 WP_000216946.1.13554 WP_000216946.1.13556 WP_000216946.1.13568 WP_000216946.1.13612 WP_000216946.1.13617 WP_000216946.1.13650 WP_000216946.1.13654 WP_000216946.1.13665 WP_000216946.1.13668 WP_000216946.1.13670 WP_000216946.1.13683 WP_000216946.1.13726 WP_000216946.1.1374 WP_000216946.1.13755 WP_000216946.1.13757 WP_000216946.1.13772 WP_000216946.1.13804 WP_000216946.1.13805 WP_000216946.1.13879 WP_000216946.1.13897 WP_000216946.1.13914 WP_000216946.1.13933 WP_000216946.1.13940 WP_000216946.1.13983 WP_000216946.1.13986 WP_000216946.1.13987 WP_000216946.1.14025 WP_000216946.1.14071 WP_000216946.1.14097 WP_000216946.1.14112 WP_000216946.1.14143 WP_000216946.1.14153 WP_000216946.1.14163 WP_000216946.1.1420 WP_000216946.1.14201 WP_000216946.1.14233 WP_000216946.1.1425 WP_000216946.1.1426 WP_000216946.1.1429 WP_000216946.1.14305 WP_000216946.1.14342 WP_000216946.1.14358 WP_000216946.1.14364 WP_000216946.1.14366 WP_000216946.1.14394 WP_000216946.1.14397 WP_000216946.1.14412 WP_000216946.1.14418 WP_000216946.1.14475 WP_000216946.1.14535 WP_000216946.1.1457 WP_000216946.1.14577 WP_000216946.1.14590 WP_000216946.1.14596 WP_000216946.1.14639 WP_000216946.1.14696 WP_000216946.1.147 WP_000216946.1.14729 WP_000216946.1.14734 WP_000216946.1.14744 WP_000216946.1.1477 WP_000216946.1.14774 WP_000216946.1.14790 WP_000216946.1.14809 WP_000216946.1.14825 WP_000216946.1.14846 WP_000216946.1.14868 WP_000216946.1.14869 WP_000216946.1.14874 WP_000216946.1.14888 WP_000216946.1.14924 WP_000216946.1.14967 WP_000216946.1.14970 WP_000216946.1.14987 WP_000216946.1.15000 WP_000216946.1.15015 WP_000216946.1.15029 WP_000216946.1.15091 WP_000216946.1.15098 WP_000216946.1.15108 WP_000216946.1.15173 WP_000216946.1.15185 WP_000216946.1.1520 WP_000216946.1.15201 WP_000216946.1.15228 WP_000216946.1.1525 WP_000216946.1.15263 WP_000216946.1.15268 WP_000216946.1.15269 WP_000216946.1.15278 WP_000216946.1.15294 WP_000216946.1.15296 WP_000216946.1.15329 WP_000216946.1.15389 WP_000216946.1.15399 WP_000216946.1.15403 WP_000216946.1.15409 WP_000216946.1.15438 WP_000216946.1.1545 WP_000216946.1.15478 WP_000216946.1.15489 WP_000216946.1.15507 WP_000216946.1.15524 WP_000216946.1.15533 WP_000216946.1.15544 WP_000216946.1.15546 WP_000216946.1.15572 WP_000216946.1.1558 WP_000216946.1.15590 WP_000216946.1.15601 WP_000216946.1.1564 WP_000216946.1.15687 WP_000216946.1.1569 WP_000216946.1.15691 WP_000216946.1.15706 WP_000216946.1.15722 WP_000216946.1.15753 WP_000216946.1.15785 WP_000216946.1.1579 WP_000216946.1.15812 WP_000216946.1.15818 WP_000216946.1.1583 WP_000216946.1.15838 WP_000216946.1.15883 WP_000216946.1.15892 WP_000216946.1.15897 WP_000216946.1.15898 WP_000216946.1.159 WP_000216946.1.15920 WP_000216946.1.15921 WP_000216946.1.15925 WP_000216946.1.15928 WP_000216946.1.15957 WP_000216946.1.15972 WP_000216946.1.1600 WP_000216946.1.16018 WP_000216946.1.1606 WP_000216946.1.16068 WP_000216946.1.16096 WP_000216946.1.16098 WP_000216946.1.16112 WP_000216946.1.16140 WP_000216946.1.16173 WP_000216946.1.16195 WP_000216946.1.16203 WP_000216946.1.16213 WP_000216946.1.16223 WP_000216946.1.1623 WP_000216946.1.16237 WP_000216946.1.16251 WP_000216946.1.16265 WP_000216946.1.16276 WP_000216946.1.16311 WP_000216946.1.16362 WP_000216946.1.16395 WP_000216946.1.16407 WP_000216946.1.16417 WP_000216946.1.16455 WP_000216946.1.16458 WP_000216946.1.16467 WP_000216946.1.16554 WP_000216946.1.16569 WP_000216946.1.16589 WP_000216946.1.16603 WP_000216946.1.16617 WP_000216946.1.16628 WP_000216946.1.16632 WP_000216946.1.16639 WP_000216946.1.1665 WP_000216946.1.16653 WP_000216946.1.16672 WP_000216946.1.16679 WP_000216946.1.16688 WP_000216946.1.16693 WP_000216946.1.16703 WP_000216946.1.16747 WP_000216946.1.16757 WP_000216946.1.16761 WP_000216946.1.16768 WP_000216946.1.16770 WP_000216946.1.16776 WP_000216946.1.16794 WP_000216946.1.16815 WP_000216946.1.16824 WP_000216946.1.16880 WP_000216946.1.16882 WP_000216946.1.16892 WP_000216946.1.16920 WP_000216946.1.16925 WP_000216946.1.16946 WP_000216946.1.16969 WP_000216946.1.170 WP_000216946.1.17012 WP_000216946.1.17038 WP_000216946.1.17046 WP_000216946.1.17050 WP_000216946.1.17080 WP_000216946.1.17104 WP_000216946.1.17122 WP_000216946.1.17132 WP_000216946.1.17137 WP_000216946.1.17139 WP_000216946.1.17157 WP_000216946.1.17169 WP_000216946.1.17180 WP_000216946.1.17210 WP_000216946.1.17231 WP_000216946.1.17240 WP_000216946.1.17249 WP_000216946.1.1725 WP_000216946.1.17256 WP_000216946.1.1729 WP_000216946.1.17309 WP_000216946.1.17320 WP_000216946.1.17327 WP_000216946.1.1736 WP_000216946.1.1740 WP_000216946.1.1741 WP_000216946.1.17419 WP_000216946.1.17450 WP_000216946.1.17454 WP_000216946.1.17485 WP_000216946.1.17520 WP_000216946.1.17529 WP_000216946.1.17531 WP_000216946.1.1756 WP_000216946.1.17581 WP_000216946.1.17590 WP_000216946.1.17643 WP_000216946.1.1765 WP_000216946.1.17650 WP_000216946.1.17657 WP_000216946.1.17666 WP_000216946.1.17671 WP_000216946.1.17676 WP_000216946.1.17717 WP_000216946.1.17718 WP_000216946.1.17725 WP_000216946.1.17729 WP_000216946.1.17737 WP_000216946.1.17770 WP_000216946.1.17796 WP_000216946.1.17818 WP_000216946.1.17832 WP_000216946.1.17834 WP_000216946.1.17845 WP_000216946.1.17847 WP_000216946.1.17853 WP_000216946.1.17876 WP_000216946.1.17909 WP_000216946.1.17922 WP_000216946.1.17929 WP_000216946.1.17943 WP_000216946.1.17951 WP_000216946.1.17987 WP_000216946.1.18011 WP_000216946.1.18016 WP_000216946.1.18035 WP_000216946.1.18069 WP_000216946.1.18074 WP_000216946.1.18080 WP_000216946.1.18105 WP_000216946.1.18113 WP_000216946.1.18140 WP_000216946.1.18153 WP_000216946.1.18197 WP_000216946.1.18203 WP_000216946.1.18237 WP_000216946.1.18248 WP_000216946.1.18261 WP_000216946.1.18283 WP_000216946.1.18288 WP_000216946.1.1829 WP_000216946.1.18290 WP_000216946.1.18301 WP_000216946.1.18309 WP_000216946.1.18310 WP_000216946.1.18320 WP_000216946.1.1835 WP_000216946.1.18360 WP_000216946.1.18412 WP_000216946.1.18429 WP_000216946.1.18437 WP_000216946.1.18451 WP_000216946.1.1847 WP_000216946.1.18487 WP_000216946.1.18506 WP_000216946.1.18507 WP_000216946.1.1851 WP_000216946.1.18516 WP_000216946.1.18527 WP_000216946.1.18529 WP_000216946.1.18538 WP_000216946.1.18539 WP_000216946.1.18560 WP_000216946.1.18567 WP_000216946.1.18570 WP_000216946.1.18611 WP_000216946.1.18627 WP_000216946.1.18632 WP_000216946.1.18658 WP_000216946.1.18668 WP_000216946.1.18679 WP_000216946.1.18741 WP_000216946.1.18758 WP_000216946.1.18777 WP_000216946.1.18792 WP_000216946.1.18809 WP_000216946.1.18818 WP_000216946.1.18819 WP_000216946.1.18830 WP_000216946.1.18834 WP_000216946.1.18836 WP_000216946.1.18879 WP_000216946.1.18882 WP_000216946.1.18918 WP_000216946.1.1892 WP_000216946.1.18938 WP_000216946.1.18965 WP_000216946.1.18968 WP_000216946.1.18987 WP_000216946.1.18996 WP_000216946.1.19009 WP_000216946.1.1901 WP_000216946.1.19022 WP_000216946.1.19027 WP_000216946.1.19052 WP_000216946.1.19082 WP_000216946.1.1911 WP_000216946.1.19149 WP_000216946.1.19179 WP_000216946.1.192 WP_000216946.1.19272 WP_000216946.1.19301 WP_000216946.1.19322 WP_000216946.1.19411 WP_000216946.1.19430 WP_000216946.1.19444 WP_000216946.1.19450 WP_000216946.1.19509 WP_000216946.1.19537 WP_000216946.1.19555 WP_000216946.1.19575 WP_000216946.1.19577 WP_000216946.1.19611 WP_000216946.1.1964 WP_000216946.1.19643 WP_000216946.1.19653 WP_000216946.1.19701 WP_000216946.1.19725 WP_000216946.1.19732 WP_000216946.1.19733 WP_000216946.1.1974 WP_000216946.1.19748 WP_000216946.1.1975 WP_000216946.1.19765 WP_000216946.1.19775 WP_000216946.1.19788 WP_000216946.1.19792 WP_000216946.1.19807 WP_000216946.1.19848 WP_000216946.1.19853 WP_000216946.1.19891 WP_000216946.1.19912 WP_000216946.1.19921 WP_000216946.1.19980 WP_000216946.1.19981 WP_000216946.1.19982 WP_000216946.1.2 WP_000216946.1.20006 WP_000216946.1.20049 WP_000216946.1.20052 WP_000216946.1.20057 WP_000216946.1.20078 WP_000216946.1.2008 WP_000216946.1.20090 WP_000216946.1.20100 WP_000216946.1.20101 WP_000216946.1.2013 WP_000216946.1.20155 WP_000216946.1.20156 WP_000216946.1.20160 WP_000216946.1.20161 WP_000216946.1.20167 WP_000216946.1.20191 WP_000216946.1.20210 WP_000216946.1.20214 WP_000216946.1.20235 WP_000216946.1.20245 WP_000216946.1.20265 WP_000216946.1.2029 WP_000216946.1.20324 WP_000216946.1.20340 WP_000216946.1.20386 WP_000216946.1.20394 WP_000216946.1.20398 WP_000216946.1.20399 WP_000216946.1.20411 WP_000216946.1.20447 WP_000216946.1.20473 WP_000216946.1.20479 WP_000216946.1.20487 WP_000216946.1.20554 WP_000216946.1.20574 WP_000216946.1.20579 WP_000216946.1.20585 WP_000216946.1.20611 WP_000216946.1.20619 WP_000216946.1.20620 WP_000216946.1.20649 WP_000216946.1.20690 WP_000216946.1.20736 WP_000216946.1.20772 WP_000216946.1.20796 WP_000216946.1.20821 WP_000216946.1.20833 WP_000216946.1.20838 WP_000216946.1.20846 WP_000216946.1.20860 WP_000216946.1.20867 WP_000216946.1.20878 WP_000216946.1.20913 WP_000216946.1.20922 WP_000216946.1.20935 WP_000216946.1.20939 WP_000216946.1.20945 WP_000216946.1.20971 WP_000216946.1.20975 WP_000216946.1.21009 WP_000216946.1.21013 WP_000216946.1.21054 WP_000216946.1.21056 WP_000216946.1.21066 WP_000216946.1.21078 WP_000216946.1.21080 WP_000216946.1.21081 WP_000216946.1.21109 WP_000216946.1.21111 WP_000216946.1.21154 WP_000216946.1.21183 WP_000216946.1.2119 WP_000216946.1.21257 WP_000216946.1.21272 WP_000216946.1.2128 WP_000216946.1.21312 WP_000216946.1.21313 WP_000216946.1.21330 WP_000216946.1.21339 WP_000216946.1.2135 WP_000216946.1.21356 WP_000216946.1.21359 WP_000216946.1.21375 WP_000216946.1.21379 WP_000216946.1.21386 WP_000216946.1.21393 WP_000216946.1.21402 WP_000216946.1.21412 WP_000216946.1.21449 WP_000216946.1.21464 WP_000216946.1.21465 WP_000216946.1.21480 WP_000216946.1.21500 WP_000216946.1.21511 WP_000216946.1.21514 WP_000216946.1.2154 WP_000216946.1.21572 WP_000216946.1.2159 WP_000216946.1.2160 WP_000216946.1.21601 WP_000216946.1.21621 WP_000216946.1.21636 WP_000216946.1.21679 WP_000216946.1.21712 WP_000216946.1.21724 WP_000216946.1.21746 WP_000216946.1.21763 WP_000216946.1.21787 WP_000216946.1.21820 WP_000216946.1.21830 WP_000216946.1.21890 WP_000216946.1.21988 WP_000216946.1.22027 WP_000216946.1.22045 WP_000216946.1.22065 WP_000216946.1.22082 WP_000216946.1.22111 WP_000216946.1.22149 WP_000216946.1.22163 WP_000216946.1.22165 WP_000216946.1.22170 WP_000216946.1.22174 WP_000216946.1.22177 WP_000216946.1.22180 WP_000216946.1.22197 WP_000216946.1.22227 WP_000216946.1.22246 WP_000216946.1.22302 WP_000216946.1.22332 WP_000216946.1.22344 WP_000216946.1.22351 WP_000216946.1.22367 WP_000216946.1.22369 WP_000216946.1.22400 WP_000216946.1.22493 WP_000216946.1.22526 WP_000216946.1.22531 WP_000216946.1.22533 WP_000216946.1.22551 WP_000216946.1.22559 WP_000216946.1.22650 WP_000216946.1.22657 WP_000216946.1.22696 WP_000216946.1.22702 WP_000216946.1.22709 WP_000216946.1.22730 WP_000216946.1.22738 WP_000216946.1.22789 WP_000216946.1.22790 WP_000216946.1.22792 WP_000216946.1.2280 WP_000216946.1.22803 WP_000216946.1.22811 WP_000216946.1.22843 WP_000216946.1.22853 WP_000216946.1.22859 WP_000216946.1.22869 WP_000216946.1.22890 WP_000216946.1.22924 WP_000216946.1.22969 WP_000216946.1.22994 WP_000216946.1.23004 WP_000216946.1.23008 WP_000216946.1.23048 WP_000216946.1.23061 WP_000216946.1.23082 WP_000216946.1.23103 WP_000216946.1.23121 WP_000216946.1.23130 WP_000216946.1.23132 WP_000216946.1.23133 WP_000216946.1.23152 WP_000216946.1.23161 WP_000216946.1.23185 WP_000216946.1.23228 WP_000216946.1.23238 WP_000216946.1.23244 WP_000216946.1.2327 WP_000216946.1.23275 WP_000216946.1.23288 WP_000216946.1.23381 WP_000216946.1.23449 WP_000216946.1.23450 WP_000216946.1.23489 WP_000216946.1.23491 WP_000216946.1.23531 WP_000216946.1.23541 WP_000216946.1.23544 WP_000216946.1.23572 WP_000216946.1.23580 WP_000216946.1.23586 WP_000216946.1.23613 WP_000216946.1.23626 WP_000216946.1.23630 WP_000216946.1.23644 WP_000216946.1.2365 WP_000216946.1.23690 WP_000216946.1.23740 WP_000216946.1.23796 WP_000216946.1.23809 WP_000216946.1.23822 WP_000216946.1.23842 WP_000216946.1.23849 WP_000216946.1.2389 WP_000216946.1.23900 WP_000216946.1.23907 WP_000216946.1.23935 WP_000216946.1.23944 WP_000216946.1.23956 WP_000216946.1.23972 WP_000216946.1.23995 WP_000216946.1.23998 WP_000216946.1.24000 WP_000216946.1.24129 WP_000216946.1.24148 WP_000216946.1.24167 WP_000216946.1.24174 WP_000216946.1.24207 WP_000216946.1.24213 WP_000216946.1.2423 WP_000216946.1.24241 WP_000216946.1.24263 WP_000216946.1.2427 WP_000216946.1.24277 WP_000216946.1.24279 WP_000216946.1.2434 WP_000216946.1.24343 WP_000216946.1.24364 WP_000216946.1.24416 WP_000216946.1.24418 WP_000216946.1.2442 WP_000216946.1.24437 WP_000216946.1.24443 WP_000216946.1.24462 WP_000216946.1.24469 WP_000216946.1.24478 WP_000216946.1.2450 WP_000216946.1.24503 WP_000216946.1.24519 WP_000216946.1.2458 WP_000216946.1.24589 WP_000216946.1.24596 WP_000216946.1.24602 WP_000216946.1.24617 WP_000216946.1.24631 WP_000216946.1.24679 WP_000216946.1.24684 WP_000216946.1.24685 WP_000216946.1.24745 WP_000216946.1.24781 WP_000216946.1.2480 WP_000216946.1.24802 WP_000216946.1.24823 WP_000216946.1.24855 WP_000216946.1.24891 WP_000216946.1.24903 WP_000216946.1.2497 WP_000216946.1.25007 WP_000216946.1.2501 WP_000216946.1.25012 WP_000216946.1.2506 WP_000216946.1.25070 WP_000216946.1.25083 WP_000216946.1.25092 WP_000216946.1.25095 WP_000216946.1.25098 WP_000216946.1.25115 WP_000216946.1.25145 WP_000216946.1.25167 WP_000216946.1.25170 WP_000216946.1.25262 WP_000216946.1.25287 WP_000216946.1.25361 WP_000216946.1.25433 WP_000216946.1.25438 WP_000216946.1.25459 WP_000216946.1.25469 WP_000216946.1.25479 WP_000216946.1.25489 WP_000216946.1.25511 WP_000216946.1.2552 WP_000216946.1.25557 WP_000216946.1.25567 WP_000216946.1.25593 WP_000216946.1.25595 WP_000216946.1.25621 WP_000216946.1.25623 WP_000216946.1.25633 WP_000216946.1.25634 WP_000216946.1.25721 WP_000216946.1.25737 WP_000216946.1.25758 WP_000216946.1.25770 WP_000216946.1.25772 WP_000216946.1.25779 WP_000216946.1.2579 WP_000216946.1.25802 WP_000216946.1.25820 WP_000216946.1.25840 WP_000216946.1.25856 WP_000216946.1.25857 WP_000216946.1.25867 WP_000216946.1.25868 WP_000216946.1.25881 WP_000216946.1.25891 WP_000216946.1.2590 WP_000216946.1.25910 WP_000216946.1.2592 WP_000216946.1.25924 WP_000216946.1.2593 WP_000216946.1.25930 WP_000216946.1.26006 WP_000216946.1.26039 WP_000216946.1.2608 WP_000216946.1.26086 WP_000216946.1.26143 WP_000216946.1.26169 WP_000216946.1.262 WP_000216946.1.2621 WP_000216946.1.26255 WP_000216946.1.26266 WP_000216946.1.26276 WP_000216946.1.26290 WP_000216946.1.26298 WP_000216946.1.26307 WP_000216946.1.26314 WP_000216946.1.26318 WP_000216946.1.2633 WP_000216946.1.26340 WP_000216946.1.26345 WP_000216946.1.26346 WP_000216946.1.26354 WP_000216946.1.26359 WP_000216946.1.26364 WP_000216946.1.26370 WP_000216946.1.26399 WP_000216946.1.26404 WP_000216946.1.26405 WP_000216946.1.2643 WP_000216946.1.26481 WP_000216946.1.26506 WP_000216946.1.2656 WP_000216946.1.2658 WP_000216946.1.2661 WP_000216946.1.2664 WP_000216946.1.26662 WP_000216946.1.26663 WP_000216946.1.26677 WP_000216946.1.26692 WP_000216946.1.2673 WP_000216946.1.26733 WP_000216946.1.2674 WP_000216946.1.26751 WP_000216946.1.26771 WP_000216946.1.26772 WP_000216946.1.26790 WP_000216946.1.26804 WP_000216946.1.2684 WP_000216946.1.26840 WP_000216946.1.26865 WP_000216946.1.26884 WP_000216946.1.2689 WP_000216946.1.26903 WP_000216946.1.26905 WP_000216946.1.26927 WP_000216946.1.26938 WP_000216946.1.26944 WP_000216946.1.26958 WP_000216946.1.27042 WP_000216946.1.27053 WP_000216946.1.27083 WP_000216946.1.27154 WP_000216946.1.27166 WP_000216946.1.27170 WP_000216946.1.2718 WP_000216946.1.27182 WP_000216946.1.2719 WP_000216946.1.27246 WP_000216946.1.2725 WP_000216946.1.27262 WP_000216946.1.27293 WP_000216946.1.27294 WP_000216946.1.27311 WP_000216946.1.27323 WP_000216946.1.27333 WP_000216946.1.2734 WP_000216946.1.27345 WP_000216946.1.27379 WP_000216946.1.27387 WP_000216946.1.27447 WP_000216946.1.27455 WP_000216946.1.27456 WP_000216946.1.27457 WP_000216946.1.27468 WP_000216946.1.2753 WP_000216946.1.27539 WP_000216946.1.27551 WP_000216946.1.27562 WP_000216946.1.2759 WP_000216946.1.27590 WP_000216946.1.27608 WP_000216946.1.27614 WP_000216946.1.27615 WP_000216946.1.27621 WP_000216946.1.27628 WP_000216946.1.27640 WP_000216946.1.27646 WP_000216946.1.27654 WP_000216946.1.27670 WP_000216946.1.27689 WP_000216946.1.27717 WP_000216946.1.27739 WP_000216946.1.27744 WP_000216946.1.27748 WP_000216946.1.27765 WP_000216946.1.27793 WP_000216946.1.27817 WP_000216946.1.27830 WP_000216946.1.27854 WP_000216946.1.2795 WP_000216946.1.27950 WP_000216946.1.27953 WP_000216946.1.27972 WP_000216946.1.28007 WP_000216946.1.28016 WP_000216946.1.28025 WP_000216946.1.28063 WP_000216946.1.28071 WP_000216946.1.28088 WP_000216946.1.28091 WP_000216946.1.28117 WP_000216946.1.28138 WP_000216946.1.28147 WP_000216946.1.28158 WP_000216946.1.28173 WP_000216946.1.28191 WP_000216946.1.28207 WP_000216946.1.28213 WP_000216946.1.28226 WP_000216946.1.28230 WP_000216946.1.28253 WP_000216946.1.28257 WP_000216946.1.28274 WP_000216946.1.28315 WP_000216946.1.28319 WP_000216946.1.28334 WP_000216946.1.28347 WP_000216946.1.28358 WP_000216946.1.28360 WP_000216946.1.28376 WP_000216946.1.28381 WP_000216946.1.28399 WP_000216946.1.28400 WP_000216946.1.28430 WP_000216946.1.28477 WP_000216946.1.28498 WP_000216946.1.28502 WP_000216946.1.2852 WP_000216946.1.28527 WP_000216946.1.28532 WP_000216946.1.28578 WP_000216946.1.28580 WP_000216946.1.28605 WP_000216946.1.28629 WP_000216946.1.28650 WP_000216946.1.28652 WP_000216946.1.28675 WP_000216946.1.28690 WP_000216946.1.28710 WP_000216946.1.28720 WP_000216946.1.28725 WP_000216946.1.28763 WP_000216946.1.28784 WP_000216946.1.28785 WP_000216946.1.28848 WP_000216946.1.28862 WP_000216946.1.28866 WP_000216946.1.28871 WP_000216946.1.28887 WP_000216946.1.28909 WP_000216946.1.28915 WP_000216946.1.28933 WP_000216946.1.28960 WP_000216946.1.28970 WP_000216946.1.28981 WP_000216946.1.28987 WP_000216946.1.29052 WP_000216946.1.29060 WP_000216946.1.29090 WP_000216946.1.29107 WP_000216946.1.29112 WP_000216946.1.29155 WP_000216946.1.29166 WP_000216946.1.29187 WP_000216946.1.29188 WP_000216946.1.29207 WP_000216946.1.29226 WP_000216946.1.29242 WP_000216946.1.29243 WP_000216946.1.29263 WP_000216946.1.29272 WP_000216946.1.29276 WP_000216946.1.29282 WP_000216946.1.29285 WP_000216946.1.29312 WP_000216946.1.29315 WP_000216946.1.29329 WP_000216946.1.29366 WP_000216946.1.29368 WP_000216946.1.29372 WP_000216946.1.29373 WP_000216946.1.29381 WP_000216946.1.29395 WP_000216946.1.29420 WP_000216946.1.29468 WP_000216946.1.29511 WP_000216946.1.29522 WP_000216946.1.29541 WP_000216946.1.29553 WP_000216946.1.29554 WP_000216946.1.29561 WP_000216946.1.2957 WP_000216946.1.29596 WP_000216946.1.29644 WP_000216946.1.29676 WP_000216946.1.29716 WP_000216946.1.2972 WP_000216946.1.29736 WP_000216946.1.29744 WP_000216946.1.29758 WP_000216946.1.29781 WP_000216946.1.29788 WP_000216946.1.29805 WP_000216946.1.2981 WP_000216946.1.29862 WP_000216946.1.29885 WP_000216946.1.29902 WP_000216946.1.29905 WP_000216946.1.29918 WP_000216946.1.29963 WP_000216946.1.29981 WP_000216946.1.30023 WP_000216946.1.30033 WP_000216946.1.30047 WP_000216946.1.30051 WP_000216946.1.30057 WP_000216946.1.30089 WP_000216946.1.30095 WP_000216946.1.30100 WP_000216946.1.30152 WP_000216946.1.30154 WP_000216946.1.30176 WP_000216946.1.30197 WP_000216946.1.30204 WP_000216946.1.30209 WP_000216946.1.30249 WP_000216946.1.30268 WP_000216946.1.30274 WP_000216946.1.30302 WP_000216946.1.30307 WP_000216946.1.30328 WP_000216946.1.30350 WP_000216946.1.30364 WP_000216946.1.30367 WP_000216946.1.30376 WP_000216946.1.30381 WP_000216946.1.30418 WP_000216946.1.30458 WP_000216946.1.30477 WP_000216946.1.30496 WP_000216946.1.30508 WP_000216946.1.30530 WP_000216946.1.30531 WP_000216946.1.30560 WP_000216946.1.30622 WP_000216946.1.30623 WP_000216946.1.30645 WP_000216946.1.30646 WP_000216946.1.30666 WP_000216946.1.30702 WP_000216946.1.30720 WP_000216946.1.30726 WP_000216946.1.30758 WP_000216946.1.30763 WP_000216946.1.3077 WP_000216946.1.30779 WP_000216946.1.30845 WP_000216946.1.30847 WP_000216946.1.30854 WP_000216946.1.30862 WP_000216946.1.30863 WP_000216946.1.30874 WP_000216946.1.30878 WP_000216946.1.30889 WP_000216946.1.30911 WP_000216946.1.30916 WP_000216946.1.3097 WP_000216946.1.30970 WP_000216946.1.30971 WP_000216946.1.30998 WP_000216946.1.31005 WP_000216946.1.31022 WP_000216946.1.31037 WP_000216946.1.31039 WP_000216946.1.31048 WP_000216946.1.31068 WP_000216946.1.31091 WP_000216946.1.31124 WP_000216946.1.31176 WP_000216946.1.31194 WP_000216946.1.31204 WP_000216946.1.31206 WP_000216946.1.31212 WP_000216946.1.3123 WP_000216946.1.31232 WP_000216946.1.31315 WP_000216946.1.31337 WP_000216946.1.31339 WP_000216946.1.31355 WP_000216946.1.31376 WP_000216946.1.31426 WP_000216946.1.31437 WP_000216946.1.31442 WP_000216946.1.31462 WP_000216946.1.31468 WP_000216946.1.31478 WP_000216946.1.31479 WP_000216946.1.315 WP_000216946.1.31505 WP_000216946.1.31529 WP_000216946.1.31539 WP_000216946.1.31567 WP_000216946.1.31611 WP_000216946.1.31638 WP_000216946.1.31642 WP_000216946.1.31647 WP_000216946.1.31653 WP_000216946.1.31667 WP_000216946.1.31686 WP_000216946.1.31753 WP_000216946.1.31787 WP_000216946.1.31797 WP_000216946.1.31817 WP_000216946.1.31827 WP_000216946.1.31828 WP_000216946.1.31842 WP_000216946.1.31892 WP_000216946.1.31897 WP_000216946.1.31925 WP_000216946.1.31931 WP_000216946.1.31949 WP_000216946.1.31990 WP_000216946.1.31994 WP_000216946.1.31997 WP_000216946.1.32003 WP_000216946.1.32005 WP_000216946.1.32029 WP_000216946.1.32059 WP_000216946.1.32067 WP_000216946.1.32118 WP_000216946.1.32122 WP_000216946.1.32125 WP_000216946.1.32160 WP_000216946.1.32207 WP_000216946.1.32217 WP_000216946.1.32244 WP_000216946.1.32248 WP_000216946.1.32281 WP_000216946.1.3229 WP_000216946.1.32295 WP_000216946.1.32339 WP_000216946.1.32365 WP_000216946.1.32384 WP_000216946.1.32405 WP_000216946.1.3242 WP_000216946.1.3244 WP_000216946.1.32454 WP_000216946.1.32464 WP_000216946.1.32474 WP_000216946.1.32481 WP_000216946.1.32483 WP_000216946.1.32514 WP_000216946.1.32534 WP_000216946.1.32555 WP_000216946.1.32565 WP_000216946.1.32607 WP_000216946.1.32634 WP_000216946.1.32645 WP_000216946.1.32739 WP_000216946.1.32746 WP_000216946.1.32764 WP_000216946.1.32770 WP_000216946.1.32800 WP_000216946.1.32921 WP_000216946.1.32939 WP_000216946.1.32954 WP_000216946.1.32965 WP_000216946.1.32987 WP_000216946.1.3299 WP_000216946.1.33038 WP_000216946.1.33048 WP_000216946.1.3306 WP_000216946.1.33067 WP_000216946.1.33110 WP_000216946.1.33123 WP_000216946.1.33138 WP_000216946.1.33147 WP_000216946.1.33172 WP_000216946.1.33212 WP_000216946.1.33213 WP_000216946.1.33250 WP_000216946.1.33252 WP_000216946.1.33255 WP_000216946.1.33266 WP_000216946.1.33296 WP_000216946.1.33307 WP_000216946.1.33335 WP_000216946.1.3335 WP_000216946.1.33350 WP_000216946.1.33357 WP_000216946.1.33372 WP_000216946.1.3338 WP_000216946.1.33388 WP_000216946.1.3341 WP_000216946.1.33416 WP_000216946.1.3342 WP_000216946.1.33426 WP_000216946.1.33432 WP_000216946.1.3345 WP_000216946.1.33463 WP_000216946.1.33468 WP_000216946.1.3347 WP_000216946.1.33483 WP_000216946.1.33484 WP_000216946.1.33507 WP_000216946.1.33520 WP_000216946.1.33575 WP_000216946.1.33594 WP_000216946.1.33626 WP_000216946.1.33627 WP_000216946.1.3363 WP_000216946.1.33650 WP_000216946.1.33654 WP_000216946.1.33692 WP_000216946.1.33695 WP_000216946.1.33718 WP_000216946.1.33724 WP_000216946.1.33735 WP_000216946.1.33737 WP_000216946.1.33743 WP_000216946.1.33756 WP_000216946.1.33765 WP_000216946.1.33766 WP_000216946.1.33769 WP_000216946.1.33778 WP_000216946.1.33792 WP_000216946.1.33804 WP_000216946.1.33813 WP_000216946.1.33899 WP_000216946.1.33940 WP_000216946.1.33949 WP_000216946.1.33963 WP_000216946.1.33966 WP_000216946.1.33968 WP_000216946.1.33971 WP_000216946.1.33983 WP_000216946.1.33994 WP_000216946.1.34026 WP_000216946.1.34030 WP_000216946.1.34051 WP_000216946.1.34062 WP_000216946.1.34069 WP_000216946.1.34080 WP_000216946.1.34100 WP_000216946.1.34105 WP_000216946.1.34112 WP_000216946.1.34128 WP_000216946.1.34132 WP_000216946.1.34168 WP_000216946.1.3418 WP_000216946.1.34182 WP_000216946.1.34194 WP_000216946.1.34209 WP_000216946.1.34244 WP_000216946.1.34250 WP_000216946.1.34251 WP_000216946.1.34280 WP_000216946.1.34285 WP_000216946.1.34334 WP_000216946.1.34361 WP_000216946.1.34381 WP_000216946.1.34403 WP_000216946.1.34410 WP_000216946.1.3442 WP_000216946.1.34436 WP_000216946.1.34471 WP_000216946.1.34482 WP_000216946.1.34492 WP_000216946.1.34502 WP_000216946.1.34510 WP_000216946.1.34512 WP_000216946.1.34526 WP_000216946.1.34531 WP_000216946.1.34569 WP_000216946.1.3461 WP_000216946.1.34620 WP_000216946.1.34677 WP_000216946.1.34716 WP_000216946.1.34723 WP_000216946.1.34737 WP_000216946.1.3474 WP_000216946.1.34741 WP_000216946.1.34767 WP_000216946.1.34818 WP_000216946.1.34847 WP_000216946.1.34865 WP_000216946.1.34890 WP_000216946.1.34918 WP_000216946.1.34923 WP_000216946.1.34926 WP_000216946.1.34967 WP_000216946.1.34998 WP_000216946.1.35014 WP_000216946.1.35031 WP_000216946.1.35032 WP_000216946.1.35059 WP_000216946.1.35062 WP_000216946.1.35089 WP_000216946.1.35097 WP_000216946.1.35110 WP_000216946.1.35121 WP_000216946.1.35233 WP_000216946.1.35276 WP_000216946.1.35285 WP_000216946.1.35289 WP_000216946.1.35297 WP_000216946.1.35314 WP_000216946.1.35334 WP_000216946.1.35340 WP_000216946.1.35342 WP_000216946.1.35391 WP_000216946.1.354 WP_000216946.1.35413 WP_000216946.1.35415 WP_000216946.1.3542 WP_000216946.1.3547 WP_000216946.1.35498 WP_000216946.1.35508 WP_000216946.1.35517 WP_000216946.1.35519 WP_000216946.1.35525 WP_000216946.1.35549 WP_000216946.1.35580 WP_000216946.1.35615 WP_000216946.1.35623 WP_000216946.1.35642 WP_000216946.1.35661 WP_000216946.1.35686 WP_000216946.1.3569 WP_000216946.1.35696 WP_000216946.1.35784 WP_000216946.1.3579 WP_000216946.1.35801 WP_000216946.1.35826 WP_000216946.1.35837 WP_000216946.1.35888 WP_000216946.1.35890 WP_000216946.1.35900 WP_000216946.1.35903 WP_000216946.1.35928 WP_000216946.1.35950 WP_000216946.1.36004 WP_000216946.1.36082 WP_000216946.1.36093 WP_000216946.1.36102 WP_000216946.1.36119 WP_000216946.1.36141 WP_000216946.1.3617 WP_000216946.1.36176 WP_000216946.1.36179 WP_000216946.1.36187 WP_000216946.1.36188 WP_000216946.1.36208 WP_000216946.1.36249 WP_000216946.1.36250 WP_000216946.1.36264 WP_000216946.1.36278 WP_000216946.1.36282 WP_000216946.1.36307 WP_000216946.1.36344 WP_000216946.1.36389 WP_000216946.1.36430 WP_000216946.1.36434 WP_000216946.1.36439 WP_000216946.1.36532 WP_000216946.1.36535 WP_000216946.1.3655 WP_000216946.1.36570 WP_000216946.1.36580 WP_000216946.1.36600 WP_000216946.1.36615 WP_000216946.1.36640 WP_000216946.1.36646 WP_000216946.1.3666 WP_000216946.1.36689 WP_000216946.1.36697 WP_000216946.1.36704 WP_000216946.1.36729 WP_000216946.1.3675 WP_000216946.1.36773 WP_000216946.1.36783 WP_000216946.1.36796 WP_000216946.1.36814 WP_000216946.1.36822 WP_000216946.1.36847 WP_000216946.1.3685 WP_000216946.1.36858 WP_000216946.1.3687 WP_000216946.1.36888 WP_000216946.1.36903 WP_000216946.1.36911 WP_000216946.1.36932 WP_000216946.1.36955 WP_000216946.1.36979 WP_000216946.1.36980 WP_000216946.1.36997 WP_000216946.1.37002 WP_000216946.1.37016 WP_000216946.1.3703 WP_000216946.1.37044 WP_000216946.1.37055 WP_000216946.1.37075 WP_000216946.1.37080 WP_000216946.1.3709 WP_000216946.1.37120 WP_000216946.1.37121 WP_000216946.1.37130 WP_000216946.1.37134 WP_000216946.1.37159 WP_000216946.1.3722 WP_000216946.1.37220 WP_000216946.1.37240 WP_000216946.1.37335 WP_000216946.1.37341 WP_000216946.1.37378 WP_000216946.1.37398 WP_000216946.1.37411 WP_000216946.1.37424 WP_000216946.1.37435 WP_000216946.1.37467 WP_000216946.1.37503 WP_000216946.1.37546 WP_000216946.1.37583 WP_000216946.1.37602 WP_000216946.1.37605 WP_000216946.1.37606 WP_000216946.1.37621 WP_000216946.1.37624 WP_000216946.1.37644 WP_000216946.1.37669 WP_000216946.1.37679 WP_000216946.1.3774 WP_000216946.1.37749 WP_000216946.1.3776 WP_000216946.1.37771 WP_000216946.1.37781 WP_000216946.1.37788 WP_000216946.1.37815 WP_000216946.1.37828 WP_000216946.1.37851 WP_000216946.1.37906 WP_000216946.1.37907 WP_000216946.1.37953 WP_000216946.1.37987 WP_000216946.1.38030 WP_000216946.1.38038 WP_000216946.1.38057 WP_000216946.1.38070 WP_000216946.1.38082 WP_000216946.1.3809 WP_000216946.1.38100 WP_000216946.1.38111 WP_000216946.1.38128 WP_000216946.1.38136 WP_000216946.1.38160 WP_000216946.1.38177 WP_000216946.1.3820 WP_000216946.1.38222 WP_000216946.1.38230 WP_000216946.1.38232 WP_000216946.1.38276 WP_000216946.1.38282 WP_000216946.1.38304 WP_000216946.1.38309 WP_000216946.1.38339 WP_000216946.1.38383 WP_000216946.1.38390 WP_000216946.1.3842 WP_000216946.1.38422 WP_000216946.1.38437 WP_000216946.1.38453 WP_000216946.1.38493 WP_000216946.1.3852 WP_000216946.1.38522 WP_000216946.1.38546 WP_000216946.1.38555 WP_000216946.1.38607 WP_000216946.1.38612 WP_000216946.1.3867 WP_000216946.1.38674 WP_000216946.1.38688 WP_000216946.1.38721 WP_000216946.1.3875 WP_000216946.1.38760 WP_000216946.1.38823 WP_000216946.1.38841 WP_000216946.1.38858 WP_000216946.1.38862 WP_000216946.1.38875 WP_000216946.1.38885 WP_000216946.1.38890 WP_000216946.1.38926 WP_000216946.1.38927 WP_000216946.1.38931 WP_000216946.1.38941 WP_000216946.1.38960 WP_000216946.1.38972 WP_000216946.1.38989 WP_000216946.1.390 WP_000216946.1.39012 WP_000216946.1.39014 WP_000216946.1.39017 WP_000216946.1.39026 WP_000216946.1.39043 WP_000216946.1.39053 WP_000216946.1.3906 WP_000216946.1.391 WP_000216946.1.39108 WP_000216946.1.39166 WP_000216946.1.39173 WP_000216946.1.39203 WP_000216946.1.39206 WP_000216946.1.39217 WP_000216946.1.3926 WP_000216946.1.39272 WP_000216946.1.39290 WP_000216946.1.39332 WP_000216946.1.39333 WP_000216946.1.39361 WP_000216946.1.39384 WP_000216946.1.39397 WP_000216946.1.39406 WP_000216946.1.39432 WP_000216946.1.39451 WP_000216946.1.39486 WP_000216946.1.39494 WP_000216946.1.39499 WP_000216946.1.39506 WP_000216946.1.39542 WP_000216946.1.39550 WP_000216946.1.39642 WP_000216946.1.39645 WP_000216946.1.39670 WP_000216946.1.39671 WP_000216946.1.39682 WP_000216946.1.39687 WP_000216946.1.39689 WP_000216946.1.39693 WP_000216946.1.39697 WP_000216946.1.39711 WP_000216946.1.39738 WP_000216946.1.39767 WP_000216946.1.39789 WP_000216946.1.39832 WP_000216946.1.39838 WP_000216946.1.39856 WP_000216946.1.39857 WP_000216946.1.39869 WP_000216946.1.39943 WP_000216946.1.39995 WP_000216946.1.40014 WP_000216946.1.40043 WP_000216946.1.40076 WP_000216946.1.40082 WP_000216946.1.40099 WP_000216946.1.4010 WP_000216946.1.40120 WP_000216946.1.40137 WP_000216946.1.40149 WP_000216946.1.4015 WP_000216946.1.40164 WP_000216946.1.40173 WP_000216946.1.4019 WP_000216946.1.40247 WP_000216946.1.40299 WP_000216946.1.40318 WP_000216946.1.40320 WP_000216946.1.40329 WP_000216946.1.40330 WP_000216946.1.40342 WP_000216946.1.40368 WP_000216946.1.40369 WP_000216946.1.40406 WP_000216946.1.40428 WP_000216946.1.4045 WP_000216946.1.40472 WP_000216946.1.40474 WP_000216946.1.40481 WP_000216946.1.40483 WP_000216946.1.40500 WP_000216946.1.40505 WP_000216946.1.40531 WP_000216946.1.40532 WP_000216946.1.4056 WP_000216946.1.4057 WP_000216946.1.40579 WP_000216946.1.40588 WP_000216946.1.40620 WP_000216946.1.40644 WP_000216946.1.40655 WP_000216946.1.40658 WP_000216946.1.40659 WP_000216946.1.40670 WP_000216946.1.40700 WP_000216946.1.40719 WP_000216946.1.40729 WP_000216946.1.40760 WP_000216946.1.40797 WP_000216946.1.40814 WP_000216946.1.40816 WP_000216946.1.40939 WP_000216946.1.40997 WP_000216946.1.41033 WP_000216946.1.41038 WP_000216946.1.4105 WP_000216946.1.41064 WP_000216946.1.41084 WP_000216946.1.41094 WP_000216946.1.41119 WP_000216946.1.41129 WP_000216946.1.4115 WP_000216946.1.41178 WP_000216946.1.41208 WP_000216946.1.41241 WP_000216946.1.41255 WP_000216946.1.41289 WP_000216946.1.4129 WP_000216946.1.41350 WP_000216946.1.41374 WP_000216946.1.41386 WP_000216946.1.41389 WP_000216946.1.41426 WP_000216946.1.41432 WP_000216946.1.41433 WP_000216946.1.41458 WP_000216946.1.41499 WP_000216946.1.41511 WP_000216946.1.41555 WP_000216946.1.41558 WP_000216946.1.41567 WP_000216946.1.41581 WP_000216946.1.41582 WP_000216946.1.41587 WP_000216946.1.41598 WP_000216946.1.41612 WP_000216946.1.41620 WP_000216946.1.41623 WP_000216946.1.41647 WP_000216946.1.41674 WP_000216946.1.41681 WP_000216946.1.4169 WP_000216946.1.41755 WP_000216946.1.41796 WP_000216946.1.4182 WP_000216946.1.41839 WP_000216946.1.41863 WP_000216946.1.4188 WP_000216946.1.41898 WP_000216946.1.41935 WP_000216946.1.41943 WP_000216946.1.41972 WP_000216946.1.41983 WP_000216946.1.41989 WP_000216946.1.420 WP_000216946.1.42003 WP_000216946.1.42015 WP_000216946.1.42017 WP_000216946.1.4202 WP_000216946.1.42028 WP_000216946.1.42056 WP_000216946.1.42064 WP_000216946.1.42072 WP_000216946.1.42085 WP_000216946.1.42087 WP_000216946.1.42125 WP_000216946.1.42137 WP_000216946.1.42169 WP_000216946.1.42178 WP_000216946.1.42198 WP_000216946.1.42230 WP_000216946.1.42241 WP_000216946.1.4225 WP_000216946.1.42269 WP_000216946.1.42298 WP_000216946.1.42305 WP_000216946.1.42325 WP_000216946.1.42355 WP_000216946.1.42403 WP_000216946.1.42436 WP_000216946.1.42459 WP_000216946.1.42481 WP_000216946.1.42510 WP_000216946.1.42593 WP_000216946.1.426 WP_000216946.1.42607 WP_000216946.1.42640 WP_000216946.1.42652 WP_000216946.1.42668 WP_000216946.1.42674 WP_000216946.1.42679 WP_000216946.1.42681 WP_000216946.1.42737 WP_000216946.1.42759 WP_000216946.1.42786 WP_000216946.1.42788 WP_000216946.1.42798 WP_000216946.1.42816 WP_000216946.1.42837 WP_000216946.1.42883 WP_000216946.1.42897 WP_000216946.1.42907 WP_000216946.1.42925 WP_000216946.1.4293 WP_000216946.1.42959 WP_000216946.1.42984 WP_000216946.1.4299 WP_000216946.1.42990 WP_000216946.1.43014 WP_000216946.1.43023 WP_000216946.1.43047 WP_000216946.1.43061 WP_000216946.1.43072 WP_000216946.1.43095 WP_000216946.1.43110 WP_000216946.1.43122 WP_000216946.1.43125 WP_000216946.1.43131 WP_000216946.1.43134 WP_000216946.1.43139 WP_000216946.1.43143 WP_000216946.1.43147 WP_000216946.1.43159 WP_000216946.1.43165 WP_000216946.1.43168 WP_000216946.1.43179 WP_000216946.1.43202 WP_000216946.1.43204 WP_000216946.1.43232 WP_000216946.1.43248 WP_000216946.1.4325 WP_000216946.1.43252 WP_000216946.1.43263 WP_000216946.1.4327 WP_000216946.1.43274 WP_000216946.1.43279 WP_000216946.1.43323 WP_000216946.1.43331 WP_000216946.1.43341 WP_000216946.1.43349 WP_000216946.1.43360 WP_000216946.1.43369 WP_000216946.1.4337 WP_000216946.1.43375 WP_000216946.1.43405 WP_000216946.1.43406 WP_000216946.1.4341 WP_000216946.1.43410 WP_000216946.1.43446 WP_000216946.1.43460 WP_000216946.1.4347 WP_000216946.1.43512 WP_000216946.1.43530 WP_000216946.1.43550 WP_000216946.1.43560 WP_000216946.1.43617 WP_000216946.1.43618 WP_000216946.1.43627 WP_000216946.1.43659 WP_000216946.1.43665 WP_000216946.1.43670 WP_000216946.1.43683 WP_000216946.1.43702 WP_000216946.1.43703 WP_000216946.1.4372 WP_000216946.1.43731 WP_000216946.1.43752 WP_000216946.1.43784 WP_000216946.1.43788 WP_000216946.1.43819 WP_000216946.1.43827 WP_000216946.1.4385 WP_000216946.1.43851 WP_000216946.1.4386 WP_000216946.1.43904 WP_000216946.1.43915 WP_000216946.1.43984 WP_000216946.1.43995 WP_000216946.1.44074 WP_000216946.1.44095 WP_000216946.1.44119 WP_000216946.1.44153 WP_000216946.1.44177 WP_000216946.1.44178 WP_000216946.1.44181 WP_000216946.1.44265 WP_000216946.1.44302 WP_000216946.1.44344 WP_000216946.1.44382 WP_000216946.1.44388 WP_000216946.1.44396 WP_000216946.1.44405 WP_000216946.1.44420 WP_000216946.1.44432 WP_000216946.1.44504 WP_000216946.1.44515 WP_000216946.1.44517 WP_000216946.1.44520 WP_000216946.1.44544 WP_000216946.1.44579 WP_000216946.1.44586 WP_000216946.1.44588 WP_000216946.1.44605 WP_000216946.1.44623 WP_000216946.1.44631 WP_000216946.1.44655 WP_000216946.1.44672 WP_000216946.1.447 WP_000216946.1.44714 WP_000216946.1.44715 WP_000216946.1.44732 WP_000216946.1.44755 WP_000216946.1.44780 WP_000216946.1.44785 WP_000216946.1.44788 WP_000216946.1.44796 WP_000216946.1.44856 WP_000216946.1.44876 WP_000216946.1.44881 WP_000216946.1.44882 WP_000216946.1.44892 WP_000216946.1.44899 WP_000216946.1.44914 WP_000216946.1.44940 WP_000216946.1.44955 WP_000216946.1.44969 WP_000216946.1.44993 WP_000216946.1.45033 WP_000216946.1.45035 WP_000216946.1.45042 WP_000216946.1.45080 WP_000216946.1.45091 WP_000216946.1.45094 WP_000216946.1.45099 WP_000216946.1.4513 WP_000216946.1.45132 WP_000216946.1.45133 WP_000216946.1.45140 WP_000216946.1.45157 WP_000216946.1.45162 WP_000216946.1.45164 WP_000216946.1.45170 WP_000216946.1.45223 WP_000216946.1.45242 WP_000216946.1.45267 WP_000216946.1.4527 WP_000216946.1.45272 WP_000216946.1.45281 WP_000216946.1.45290 WP_000216946.1.45297 WP_000216946.1.453 WP_000216946.1.45364 WP_000216946.1.45419 WP_000216946.1.45431 WP_000216946.1.45439 WP_000216946.1.4545 WP_000216946.1.45450 WP_000216946.1.45456 WP_000216946.1.4546 WP_000216946.1.45472 WP_000216946.1.45492 WP_000216946.1.4550 WP_000216946.1.45507 WP_000216946.1.45542 WP_000216946.1.45555 WP_000216946.1.45560 WP_000216946.1.45574 WP_000216946.1.45577 WP_000216946.1.45610 WP_000216946.1.45620 WP_000216946.1.45645 WP_000216946.1.45670 WP_000216946.1.45698 WP_000216946.1.45703 WP_000216946.1.45705 WP_000216946.1.45730 WP_000216946.1.45734 WP_000216946.1.45763 WP_000216946.1.45768 WP_000216946.1.4577 WP_000216946.1.45771 WP_000216946.1.45773 WP_000216946.1.45780 WP_000216946.1.4582 WP_000216946.1.45833 WP_000216946.1.4584 WP_000216946.1.45852 WP_000216946.1.45859 WP_000216946.1.45862 WP_000216946.1.45874 WP_000216946.1.45897 WP_000216946.1.45954 WP_000216946.1.4597 WP_000216946.1.45972 WP_000216946.1.45977 WP_000216946.1.45979 WP_000216946.1.4598 WP_000216946.1.46003 WP_000216946.1.46005 WP_000216946.1.46021 WP_000216946.1.46035 WP_000216946.1.46037 WP_000216946.1.46050 WP_000216946.1.46055 WP_000216946.1.46062 WP_000216946.1.46078 WP_000216946.1.46087 WP_000216946.1.46168 WP_000216946.1.46171 WP_000216946.1.46172 WP_000216946.1.46185 WP_000216946.1.46195 WP_000216946.1.46208 WP_000216946.1.46222 WP_000216946.1.46228 WP_000216946.1.46248 WP_000216946.1.46259 WP_000216946.1.46276 WP_000216946.1.46330 WP_000216946.1.46333 WP_000216946.1.46334 WP_000216946.1.46339 WP_000216946.1.46353 WP_000216946.1.46362 WP_000216946.1.46368 WP_000216946.1.46380 WP_000216946.1.46389 WP_000216946.1.46401 WP_000216946.1.46422 WP_000216946.1.46465 WP_000216946.1.46529 WP_000216946.1.46543 WP_000216946.1.46619 WP_000216946.1.4662 WP_000216946.1.46648 WP_000216946.1.46660 WP_000216946.1.46664 WP_000216946.1.46670 WP_000216946.1.46692 WP_000216946.1.46702 WP_000216946.1.46703 WP_000216946.1.46720 WP_000216946.1.46736 WP_000216946.1.46752 WP_000216946.1.46765 WP_000216946.1.46770 WP_000216946.1.46852 WP_000216946.1.46881 WP_000216946.1.46906 WP_000216946.1.46908 WP_000216946.1.46911 WP_000216946.1.46914 WP_000216946.1.46925 WP_000216946.1.46929 WP_000216946.1.46937 WP_000216946.1.4694 WP_000216946.1.46947 WP_000216946.1.46983 WP_000216946.1.46995 WP_000216946.1.47002 WP_000216946.1.47051 WP_000216946.1.47065 WP_000216946.1.47105 WP_000216946.1.47107 WP_000216946.1.47111 WP_000216946.1.47128 WP_000216946.1.47153 WP_000216946.1.47159 WP_000216946.1.47163 WP_000216946.1.47175 WP_000216946.1.47187 WP_000216946.1.47193 WP_000216946.1.47211 WP_000216946.1.47216 WP_000216946.1.47258 WP_000216946.1.47269 WP_000216946.1.47279 WP_000216946.1.4728 WP_000216946.1.47282 WP_000216946.1.47290 WP_000216946.1.47294 WP_000216946.1.47306 WP_000216946.1.47328 WP_000216946.1.47334 WP_000216946.1.47381 WP_000216946.1.47399 WP_000216946.1.47406 WP_000216946.1.47408 WP_000216946.1.47426 WP_000216946.1.47439 WP_000216946.1.47459 WP_000216946.1.47493 WP_000216946.1.47522 WP_000216946.1.47541 WP_000216946.1.47560 WP_000216946.1.47617 WP_000216946.1.47618 WP_000216946.1.47629 WP_000216946.1.4767 WP_000216946.1.47680 WP_000216946.1.477 WP_000216946.1.47702 WP_000216946.1.47733 WP_000216946.1.47747 WP_000216946.1.47763 WP_000216946.1.47782 WP_000216946.1.47836 WP_000216946.1.47851 WP_000216946.1.47859 WP_000216946.1.47864 WP_000216946.1.47872 WP_000216946.1.47873 WP_000216946.1.47904 WP_000216946.1.47908 WP_000216946.1.4792 WP_000216946.1.47996 WP_000216946.1.48011 WP_000216946.1.48030 WP_000216946.1.48046 WP_000216946.1.48047 WP_000216946.1.4805 WP_000216946.1.48064 WP_000216946.1.48067 WP_000216946.1.48116 WP_000216946.1.48142 WP_000216946.1.48149 WP_000216946.1.4815 WP_000216946.1.48154 WP_000216946.1.48156 WP_000216946.1.48169 WP_000216946.1.48186 WP_000216946.1.48187 WP_000216946.1.48223 WP_000216946.1.48227 WP_000216946.1.48236 WP_000216946.1.48250 WP_000216946.1.48272 WP_000216946.1.48282 WP_000216946.1.48284 WP_000216946.1.48293 WP_000216946.1.48307 WP_000216946.1.48310 WP_000216946.1.48322 WP_000216946.1.48376 WP_000216946.1.48391 WP_000216946.1.48394 WP_000216946.1.48398 WP_000216946.1.4840 WP_000216946.1.48427 WP_000216946.1.48437 WP_000216946.1.48438 WP_000216946.1.48463 WP_000216946.1.48479 WP_000216946.1.4852 WP_000216946.1.48563 WP_000216946.1.48577 WP_000216946.1.48593 WP_000216946.1.48634 WP_000216946.1.48656 WP_000216946.1.48664 WP_000216946.1.48670 WP_000216946.1.4868 WP_000216946.1.48705 WP_000216946.1.48711 WP_000216946.1.48723 WP_000216946.1.48769 WP_000216946.1.48782 WP_000216946.1.48805 WP_000216946.1.48817 WP_000216946.1.48823 WP_000216946.1.48833 WP_000216946.1.48835 WP_000216946.1.4886 WP_000216946.1.48869 WP_000216946.1.48936 WP_000216946.1.48941 WP_000216946.1.48945 WP_000216946.1.48951 WP_000216946.1.48968 WP_000216946.1.48982 WP_000216946.1.48993 WP_000216946.1.4901 WP_000216946.1.49018 WP_000216946.1.49032 WP_000216946.1.4905 WP_000216946.1.49071 WP_000216946.1.49094 WP_000216946.1.49105 WP_000216946.1.49128 WP_000216946.1.49129 WP_000216946.1.49159 WP_000216946.1.4916 WP_000216946.1.49161 WP_000216946.1.4917 WP_000216946.1.49171 WP_000216946.1.4918 WP_000216946.1.49189 WP_000216946.1.49196 WP_000216946.1.49199 WP_000216946.1.49207 WP_000216946.1.4924 WP_000216946.1.49248 WP_000216946.1.49257 WP_000216946.1.49301 WP_000216946.1.49326 WP_000216946.1.49327 WP_000216946.1.49362 WP_000216946.1.49398 WP_000216946.1.49418 WP_000216946.1.49444 WP_000216946.1.4945 WP_000216946.1.49479 WP_000216946.1.4950 WP_000216946.1.49518 WP_000216946.1.49539 WP_000216946.1.49549 WP_000216946.1.49581 WP_000216946.1.49582 WP_000216946.1.496 WP_000216946.1.49603 WP_000216946.1.4962 WP_000216946.1.49643 WP_000216946.1.49653 WP_000216946.1.49669 WP_000216946.1.49672 WP_000216946.1.49690 WP_000216946.1.49728 WP_000216946.1.49730 WP_000216946.1.49732 WP_000216946.1.49742 WP_000216946.1.49745 WP_000216946.1.4980 WP_000216946.1.49800 WP_000216946.1.49819 WP_000216946.1.4982 WP_000216946.1.49860 WP_000216946.1.49863 WP_000216946.1.49871 WP_000216946.1.4989 WP_000216946.1.49894 WP_000216946.1.49907 WP_000216946.1.49918 WP_000216946.1.49934 WP_000216946.1.49935 WP_000216946.1.4994 WP_000216946.1.49970 WP_000216946.1.49982 WP_000216946.1.50013 WP_000216946.1.50028 WP_000216946.1.50038 WP_000216946.1.50039 WP_000216946.1.50061 WP_000216946.1.50076 WP_000216946.1.50117 WP_000216946.1.5013 WP_000216946.1.50138 WP_000216946.1.50145 WP_000216946.1.50178 WP_000216946.1.50192 WP_000216946.1.50217 WP_000216946.1.50219 WP_000216946.1.50261 WP_000216946.1.50291 WP_000216946.1.50313 WP_000216946.1.50314 WP_000216946.1.50356 WP_000216946.1.50367 WP_000216946.1.50369 WP_000216946.1.50388 WP_000216946.1.50425 WP_000216946.1.50430 WP_000216946.1.5045 WP_000216946.1.50464 WP_000216946.1.50525 WP_000216946.1.50536 WP_000216946.1.50555 WP_000216946.1.50556 WP_000216946.1.50558 WP_000216946.1.50568 WP_000216946.1.50578 WP_000216946.1.5059 WP_000216946.1.50594 WP_000216946.1.50595 WP_000216946.1.50647 WP_000216946.1.50660 WP_000216946.1.50699 WP_000216946.1.50740 WP_000216946.1.50768 WP_000216946.1.50799 WP_000216946.1.50817 WP_000216946.1.50820 WP_000216946.1.50829 WP_000216946.1.5087 WP_000216946.1.50884 WP_000216946.1.50896 WP_000216946.1.50937 WP_000216946.1.50962 WP_000216946.1.50974 WP_000216946.1.51015 WP_000216946.1.5108 WP_000216946.1.5109 WP_000216946.1.5110 WP_000216946.1.5111 WP_000216946.1.51130 WP_000216946.1.51152 WP_000216946.1.51209 WP_000216946.1.51220 WP_000216946.1.51226 WP_000216946.1.51236 WP_000216946.1.51245 WP_000216946.1.51250 WP_000216946.1.51277 WP_000216946.1.51282 WP_000216946.1.51295 WP_000216946.1.51306 WP_000216946.1.51310 WP_000216946.1.51326 WP_000216946.1.51346 WP_000216946.1.51376 WP_000216946.1.51393 WP_000216946.1.51403 WP_000216946.1.51454 WP_000216946.1.51456 WP_000216946.1.51492 WP_000216946.1.51496 WP_000216946.1.515 WP_000216946.1.51527 WP_000216946.1.5155 WP_000216946.1.51557 WP_000216946.1.51559 WP_000216946.1.51575 WP_000216946.1.51590 WP_000216946.1.51665 WP_000216946.1.51716 WP_000216946.1.51741 WP_000216946.1.51744 WP_000216946.1.51748 WP_000216946.1.51794 WP_000216946.1.51797 WP_000216946.1.51824 WP_000216946.1.51836 WP_000216946.1.51842 WP_000216946.1.51844 WP_000216946.1.51871 WP_000216946.1.51883 WP_000216946.1.51912 WP_000216946.1.51924 WP_000216946.1.51936 WP_000216946.1.51952 WP_000216946.1.51971 WP_000216946.1.51995 WP_000216946.1.52034 WP_000216946.1.52061 WP_000216946.1.52072 WP_000216946.1.52078 WP_000216946.1.521 WP_000216946.1.5213 WP_000216946.1.52151 WP_000216946.1.52182 WP_000216946.1.52185 WP_000216946.1.52193 WP_000216946.1.52195 WP_000216946.1.52198 WP_000216946.1.52210 WP_000216946.1.52224 WP_000216946.1.52251 WP_000216946.1.52289 WP_000216946.1.52296 WP_000216946.1.523 WP_000216946.1.52308 WP_000216946.1.5231 WP_000216946.1.52327 WP_000216946.1.52331 WP_000216946.1.52340 WP_000216946.1.52343 WP_000216946.1.52377 WP_000216946.1.52396 WP_000216946.1.52427 WP_000216946.1.52440 WP_000216946.1.52442 WP_000216946.1.52452 WP_000216946.1.52463 WP_000216946.1.5251 WP_000216946.1.52511 WP_000216946.1.52518 WP_000216946.1.52548 WP_000216946.1.52595 WP_000216946.1.52623 WP_000216946.1.52624 WP_000216946.1.52633 WP_000216946.1.52645 WP_000216946.1.52670 WP_000216946.1.52687 WP_000216946.1.52699 WP_000216946.1.52715 WP_000216946.1.52722 WP_000216946.1.52830 WP_000216946.1.52848 WP_000216946.1.52877 WP_000216946.1.52878 WP_000216946.1.52889 WP_000216946.1.52900 WP_000216946.1.52941 WP_000216946.1.52947 WP_000216946.1.52965 WP_000216946.1.52983 WP_000216946.1.52984 WP_000216946.1.53002 WP_000216946.1.5304 WP_000216946.1.53050 WP_000216946.1.53057 WP_000216946.1.53071 WP_000216946.1.53140 WP_000216946.1.53153 WP_000216946.1.53178 WP_000216946.1.5319 WP_000216946.1.53209 WP_000216946.1.53245 WP_000216946.1.53260 WP_000216946.1.53312 WP_000216946.1.53317 WP_000216946.1.53319 WP_000216946.1.53323 WP_000216946.1.53373 WP_000216946.1.53379 WP_000216946.1.53387 WP_000216946.1.53394 WP_000216946.1.53403 WP_000216946.1.53408 WP_000216946.1.53418 WP_000216946.1.53432 WP_000216946.1.53452 WP_000216946.1.53462 WP_000216946.1.53467 WP_000216946.1.5347 WP_000216946.1.53521 WP_000216946.1.53532 WP_000216946.1.53577 WP_000216946.1.53641 WP_000216946.1.53648 WP_000216946.1.53671 WP_000216946.1.53691 WP_000216946.1.53759 WP_000216946.1.53766 WP_000216946.1.53774 WP_000216946.1.53799 WP_000216946.1.53827 WP_000216946.1.53835 WP_000216946.1.53889 WP_000216946.1.53911 WP_000216946.1.53915 WP_000216946.1.53926 WP_000216946.1.53969 WP_000216946.1.53999 WP_000216946.1.5401 WP_000216946.1.54022 WP_000216946.1.54049 WP_000216946.1.54074 WP_000216946.1.54086 WP_000216946.1.54094 WP_000216946.1.54109 WP_000216946.1.54147 WP_000216946.1.54229 WP_000216946.1.54237 WP_000216946.1.54253 WP_000216946.1.54290 WP_000216946.1.54297 WP_000216946.1.54299 WP_000216946.1.54395 WP_000216946.1.544 WP_000216946.1.54413 WP_000216946.1.54446 WP_000216946.1.54471 WP_000216946.1.54479 WP_000216946.1.54485 WP_000216946.1.54491 WP_000216946.1.54510 WP_000216946.1.54543 WP_000216946.1.54551 WP_000216946.1.54554 WP_000216946.1.54574 WP_000216946.1.54637 WP_000216946.1.54675 WP_000216946.1.5469 WP_000216946.1.54744 WP_000216946.1.54745 WP_000216946.1.54753 WP_000216946.1.54830 WP_000216946.1.54851 WP_000216946.1.54878 WP_000216946.1.54929 WP_000216946.1.54931 WP_000216946.1.54955 WP_000216946.1.54967 WP_000216946.1.5500 WP_000216946.1.55004 WP_000216946.1.55014 WP_000216946.1.55058 WP_000216946.1.55082 WP_000216946.1.55084 WP_000216946.1.55095 WP_000216946.1.55139 WP_000216946.1.5518 WP_000216946.1.5519 WP_000216946.1.552 WP_000216946.1.55214 WP_000216946.1.55239 WP_000216946.1.55271 WP_000216946.1.55272 WP_000216946.1.55274 WP_000216946.1.55309 WP_000216946.1.55327 WP_000216946.1.55336 WP_000216946.1.55367 WP_000216946.1.55369 WP_000216946.1.55403 WP_000216946.1.55405 WP_000216946.1.55419 WP_000216946.1.55421 WP_000216946.1.55495 WP_000216946.1.5550 WP_000216946.1.55508 WP_000216946.1.55527 WP_000216946.1.55535 WP_000216946.1.5554 WP_000216946.1.55544 WP_000216946.1.55558 WP_000216946.1.5556 WP_000216946.1.55583 WP_000216946.1.5559 WP_000216946.1.55603 WP_000216946.1.5562 WP_000216946.1.55628 WP_000216946.1.55637 WP_000216946.1.55653 WP_000216946.1.557 WP_000216946.1.55719 WP_000216946.1.55724 WP_000216946.1.55728 WP_000216946.1.55784 WP_000216946.1.55786 WP_000216946.1.5580 WP_000216946.1.55818 WP_000216946.1.55831 WP_000216946.1.55835 WP_000216946.1.55845 WP_000216946.1.55867 WP_000216946.1.55886 WP_000216946.1.5589 WP_000216946.1.55904 WP_000216946.1.55916 WP_000216946.1.55933 WP_000216946.1.55955 WP_000216946.1.55985 WP_000216946.1.56000 WP_000216946.1.56003 WP_000216946.1.56025 WP_000216946.1.5604 WP_000216946.1.56048 WP_000216946.1.56064 WP_000216946.1.56078 WP_000216946.1.56098 WP_000216946.1.56106 WP_000216946.1.56135 WP_000216946.1.56159 WP_000216946.1.56220 WP_000216946.1.56225 WP_000216946.1.5623 WP_000216946.1.56237 WP_000216946.1.56239 WP_000216946.1.56281 WP_000216946.1.56332 WP_000216946.1.56333 WP_000216946.1.5635 WP_000216946.1.5637 WP_000216946.1.56377 WP_000216946.1.56387 WP_000216946.1.56400 WP_000216946.1.5644 WP_000216946.1.56464 WP_000216946.1.56482 WP_000216946.1.56527 WP_000216946.1.56542 WP_000216946.1.56558 WP_000216946.1.5658 WP_000216946.1.56584 WP_000216946.1.56598 WP_000216946.1.566 WP_000216946.1.56608 WP_000216946.1.56619 WP_000216946.1.56628 WP_000216946.1.56641 WP_000216946.1.56658 WP_000216946.1.5666 WP_000216946.1.56702 WP_000216946.1.56708 WP_000216946.1.56737 WP_000216946.1.5675 WP_000216946.1.56767 WP_000216946.1.5677 WP_000216946.1.56778 WP_000216946.1.56794 WP_000216946.1.56815 WP_000216946.1.56822 WP_000216946.1.56856 WP_000216946.1.5686 WP_000216946.1.56865 WP_000216946.1.56878 WP_000216946.1.569 WP_000216946.1.56903 WP_000216946.1.56931 WP_000216946.1.56966 WP_000216946.1.56975 WP_000216946.1.56986 WP_000216946.1.57015 WP_000216946.1.57047 WP_000216946.1.5705 WP_000216946.1.57073 WP_000216946.1.57075 WP_000216946.1.57081 WP_000216946.1.57097 WP_000216946.1.57109 WP_000216946.1.57115 WP_000216946.1.57141 WP_000216946.1.57170 WP_000216946.1.5718 WP_000216946.1.57190 WP_000216946.1.57196 WP_000216946.1.57214 WP_000216946.1.57309 WP_000216946.1.57330 WP_000216946.1.57338 WP_000216946.1.57427 WP_000216946.1.57445 WP_000216946.1.57448 WP_000216946.1.57481 WP_000216946.1.57593 WP_000216946.1.57594 WP_000216946.1.57650 WP_000216946.1.57665 WP_000216946.1.57682 WP_000216946.1.57692 WP_000216946.1.57693 WP_000216946.1.57701 WP_000216946.1.57718 WP_000216946.1.57723 WP_000216946.1.57727 WP_000216946.1.57730 WP_000216946.1.57734 WP_000216946.1.57745 WP_000216946.1.57754 WP_000216946.1.57783 WP_000216946.1.57808 WP_000216946.1.57819 WP_000216946.1.57837 WP_000216946.1.57840 WP_000216946.1.57844 WP_000216946.1.57861 WP_000216946.1.57878 WP_000216946.1.5791 WP_000216946.1.57943 WP_000216946.1.57952 WP_000216946.1.57962 WP_000216946.1.57974 WP_000216946.1.5799 WP_000216946.1.58006 WP_000216946.1.58016 WP_000216946.1.58035 WP_000216946.1.58049 WP_000216946.1.58051 WP_000216946.1.58074 WP_000216946.1.58116 WP_000216946.1.58122 WP_000216946.1.58127 WP_000216946.1.58148 WP_000216946.1.58158 WP_000216946.1.5816 WP_000216946.1.5817 WP_000216946.1.58185 WP_000216946.1.58198 WP_000216946.1.58241 WP_000216946.1.58246 WP_000216946.1.58277 WP_000216946.1.58317 WP_000216946.1.58321 WP_000216946.1.58325 WP_000216946.1.58352 WP_000216946.1.58353 WP_000216946.1.58364 WP_000216946.1.58366 WP_000216946.1.58373 WP_000216946.1.58392 WP_000216946.1.58395 WP_000216946.1.58419 WP_000216946.1.58430 WP_000216946.1.58435 WP_000216946.1.58481 WP_000216946.1.5849 WP_000216946.1.58508 WP_000216946.1.58512 WP_000216946.1.58521 WP_000216946.1.58530 WP_000216946.1.58538 WP_000216946.1.5857 WP_000216946.1.58571 WP_000216946.1.58592 WP_000216946.1.58598 WP_000216946.1.586 WP_000216946.1.58603 WP_000216946.1.58686 WP_000216946.1.58704 WP_000216946.1.58714 WP_000216946.1.58735 WP_000216946.1.58760 WP_000216946.1.58763 WP_000216946.1.58772 WP_000216946.1.58775 WP_000216946.1.5880 WP_000216946.1.58833 WP_000216946.1.58855 WP_000216946.1.58934 WP_000216946.1.58936 WP_000216946.1.58960 WP_000216946.1.58981 WP_000216946.1.58998 WP_000216946.1.5901 WP_000216946.1.59011 WP_000216946.1.59014 WP_000216946.1.59039 WP_000216946.1.5904 WP_000216946.1.59077 WP_000216946.1.59098 WP_000216946.1.59124 WP_000216946.1.59133 WP_000216946.1.59146 WP_000216946.1.59187 WP_000216946.1.5920 WP_000216946.1.5925 WP_000216946.1.59269 WP_000216946.1.59284 WP_000216946.1.59311 WP_000216946.1.59327 WP_000216946.1.59329 WP_000216946.1.59337 WP_000216946.1.59363 WP_000216946.1.59397 WP_000216946.1.59398 WP_000216946.1.5940 WP_000216946.1.59404 WP_000216946.1.59457 WP_000216946.1.59459 WP_000216946.1.59462 WP_000216946.1.59464 WP_000216946.1.59467 WP_000216946.1.59478 WP_000216946.1.59498 WP_000216946.1.59540 WP_000216946.1.59546 WP_000216946.1.59598 WP_000216946.1.59603 WP_000216946.1.59609 WP_000216946.1.59624 WP_000216946.1.59629 WP_000216946.1.59643 WP_000216946.1.59663 WP_000216946.1.59668 WP_000216946.1.59669 WP_000216946.1.59671 WP_000216946.1.59697 WP_000216946.1.5972 WP_000216946.1.59787 WP_000216946.1.5982 WP_000216946.1.59822 WP_000216946.1.59874 WP_000216946.1.59881 WP_000216946.1.59886 WP_000216946.1.59907 WP_000216946.1.59977 WP_000216946.1.60006 WP_000216946.1.60022 WP_000216946.1.6006 WP_000216946.1.6011 WP_000216946.1.60123 WP_000216946.1.60147 WP_000216946.1.60149 WP_000216946.1.60156 WP_000216946.1.60157 WP_000216946.1.6017 WP_000216946.1.60181 WP_000216946.1.60227 WP_000216946.1.60251 WP_000216946.1.60259 WP_000216946.1.60280 WP_000216946.1.60302 WP_000216946.1.60307 WP_000216946.1.60345 WP_000216946.1.60353 WP_000216946.1.60360 WP_000216946.1.60368 WP_000216946.1.60431 WP_000216946.1.60434 WP_000216946.1.60462 WP_000216946.1.60492 WP_000216946.1.60515 WP_000216946.1.60547 WP_000216946.1.60551 WP_000216946.1.60585 WP_000216946.1.60594 WP_000216946.1.60595 WP_000216946.1.60636 WP_000216946.1.60641 WP_000216946.1.60690 WP_000216946.1.60696 WP_000216946.1.60734 WP_000216946.1.60750 WP_000216946.1.60751 WP_000216946.1.60758 WP_000216946.1.60759 WP_000216946.1.60765 WP_000216946.1.60778 WP_000216946.1.60787 WP_000216946.1.60813 WP_000216946.1.60820 WP_000216946.1.60845 WP_000216946.1.6085 WP_000216946.1.60869 WP_000216946.1.60888 WP_000216946.1.60898 WP_000216946.1.60912 WP_000216946.1.60923 WP_000216946.1.60939 WP_000216946.1.60948 WP_000216946.1.60965 WP_000216946.1.60981 WP_000216946.1.60991 WP_000216946.1.61009 WP_000216946.1.61013 WP_000216946.1.61023 WP_000216946.1.61026 WP_000216946.1.61029 WP_000216946.1.61030 WP_000216946.1.61031 WP_000216946.1.61082 WP_000216946.1.61115 WP_000216946.1.61119 WP_000216946.1.61139 WP_000216946.1.61152 WP_000216946.1.61153 WP_000216946.1.6118 WP_000216946.1.61188 WP_000216946.1.61189 WP_000216946.1.6119 WP_000216946.1.61224 WP_000216946.1.6123 WP_000216946.1.61257 WP_000216946.1.61263 WP_000216946.1.61271 WP_000216946.1.61286 WP_000216946.1.61289 WP_000216946.1.61313 WP_000216946.1.61316 WP_000216946.1.61324 WP_000216946.1.61339 WP_000216946.1.6136 WP_000216946.1.61375 WP_000216946.1.61394 WP_000216946.1.61408 WP_000216946.1.61413 WP_000216946.1.61430 WP_000216946.1.61439 WP_000216946.1.61440 WP_000216946.1.61547 WP_000216946.1.61555 WP_000216946.1.61585 WP_000216946.1.61591 WP_000216946.1.61597 WP_000216946.1.61615 WP_000216946.1.61639 WP_000216946.1.6166 WP_000216946.1.6168 WP_000216946.1.61705 WP_000216946.1.61749 WP_000216946.1.61784 WP_000216946.1.61800 WP_000216946.1.61802 WP_000216946.1.61838 WP_000216946.1.61897 WP_000216946.1.61903 WP_000216946.1.61910 WP_000216946.1.61936 WP_000216946.1.61970 WP_000216946.1.61978 WP_000216946.1.62002 WP_000216946.1.6201 WP_000216946.1.62028 WP_000216946.1.62030 WP_000216946.1.62069 WP_000216946.1.62071 WP_000216946.1.62088 WP_000216946.1.62093 WP_000216946.1.62096 WP_000216946.1.62140 WP_000216946.1.62164 WP_000216946.1.62247 WP_000216946.1.62254 WP_000216946.1.62346 WP_000216946.1.62352 WP_000216946.1.62367 WP_000216946.1.62382 WP_000216946.1.62398 WP_000216946.1.62409 WP_000216946.1.62429 WP_000216946.1.62453 WP_000216946.1.62459 WP_000216946.1.62474 WP_000216946.1.62496 WP_000216946.1.6250 WP_000216946.1.62537 WP_000216946.1.62539 WP_000216946.1.62553 WP_000216946.1.62575 WP_000216946.1.62602 WP_000216946.1.62625 WP_000216946.1.62630 WP_000216946.1.62653 WP_000216946.1.62671 WP_000216946.1.62674 WP_000216946.1.6268 WP_000216946.1.62684 WP_000216946.1.62685 WP_000216946.1.62723 WP_000216946.1.62740 WP_000216946.1.62756 WP_000216946.1.62764 WP_000216946.1.62771 WP_000216946.1.62781 WP_000216946.1.62796 WP_000216946.1.62808 WP_000216946.1.62822 WP_000216946.1.62824 WP_000216946.1.62829 WP_000216946.1.62831 WP_000216946.1.62842 WP_000216946.1.62863 WP_000216946.1.62878 WP_000216946.1.62880 WP_000216946.1.62956 WP_000216946.1.62970 WP_000216946.1.63003 WP_000216946.1.63004 WP_000216946.1.63011 WP_000216946.1.63027 WP_000216946.1.63050 WP_000216946.1.63052 WP_000216946.1.63068 WP_000216946.1.63070 WP_000216946.1.63083 WP_000216946.1.631 WP_000216946.1.63132 WP_000216946.1.63139 WP_000216946.1.63140 WP_000216946.1.63182 WP_000216946.1.63195 WP_000216946.1.63215 WP_000216946.1.63220 WP_000216946.1.63233 WP_000216946.1.63244 WP_000216946.1.63266 WP_000216946.1.63273 WP_000216946.1.63279 WP_000216946.1.63289 WP_000216946.1.63296 WP_000216946.1.63304 WP_000216946.1.63307 WP_000216946.1.63313 WP_000216946.1.63319 WP_000216946.1.63322 WP_000216946.1.63324 WP_000216946.1.63333 WP_000216946.1.63341 WP_000216946.1.63383 WP_000216946.1.634 WP_000216946.1.63406 WP_000216946.1.63411 WP_000216946.1.63421 WP_000216946.1.63441 WP_000216946.1.63460 WP_000216946.1.63469 WP_000216946.1.63471 WP_000216946.1.63510 WP_000216946.1.63527 WP_000216946.1.63565 WP_000216946.1.63589 WP_000216946.1.63617 WP_000216946.1.63673 WP_000216946.1.63678 WP_000216946.1.63693 WP_000216946.1.63705 WP_000216946.1.63726 WP_000216946.1.63729 WP_000216946.1.6374 WP_000216946.1.63751 WP_000216946.1.63759 WP_000216946.1.63774 WP_000216946.1.6378 WP_000216946.1.63828 WP_000216946.1.63847 WP_000216946.1.6388 WP_000216946.1.63894 WP_000216946.1.63907 WP_000216946.1.63947 WP_000216946.1.64012 WP_000216946.1.6403 WP_000216946.1.6408 WP_000216946.1.64094 WP_000216946.1.64108 WP_000216946.1.64192 WP_000216946.1.64207 WP_000216946.1.64250 WP_000216946.1.64251 WP_000216946.1.64304 WP_000216946.1.64367 WP_000216946.1.64368 WP_000216946.1.6438 WP_000216946.1.64440 WP_000216946.1.64456 WP_000216946.1.64457 WP_000216946.1.64473 WP_000216946.1.64525 WP_000216946.1.64565 WP_000216946.1.64583 WP_000216946.1.6459 WP_000216946.1.64598 WP_000216946.1.6462 WP_000216946.1.64628 WP_000216946.1.64631 WP_000216946.1.64643 WP_000216946.1.64665 WP_000216946.1.64677 WP_000216946.1.64686 WP_000216946.1.64720 WP_000216946.1.64765 WP_000216946.1.6479 WP_000216946.1.64811 WP_000216946.1.64845 WP_000216946.1.64858 WP_000216946.1.64860 WP_000216946.1.64879 WP_000216946.1.6488 WP_000216946.1.64893 WP_000216946.1.64897 WP_000216946.1.64928 WP_000216946.1.64935 WP_000216946.1.64951 WP_000216946.1.64956 WP_000216946.1.64961 WP_000216946.1.64994 WP_000216946.1.64996 WP_000216946.1.64998 WP_000216946.1.65025 WP_000216946.1.65033 WP_000216946.1.65038 WP_000216946.1.65044 WP_000216946.1.65046 WP_000216946.1.65076 WP_000216946.1.65132 WP_000216946.1.65158 WP_000216946.1.65180 WP_000216946.1.65193 WP_000216946.1.65217 WP_000216946.1.65233 WP_000216946.1.65243 WP_000216946.1.65264 WP_000216946.1.65317 WP_000216946.1.65358 WP_000216946.1.65367 WP_000216946.1.65387 WP_000216946.1.65419 WP_000216946.1.65423 WP_000216946.1.65432 WP_000216946.1.6544 WP_000216946.1.65443 WP_000216946.1.65448 WP_000216946.1.65451 WP_000216946.1.6547 WP_000216946.1.65504 WP_000216946.1.6551 WP_000216946.1.65520 WP_000216946.1.65544 WP_000216946.1.65562 WP_000216946.1.65585 WP_000216946.1.65600 WP_000216946.1.65616 WP_000216946.1.65629 WP_000216946.1.65643 WP_000216946.1.65656 WP_000216946.1.65675 WP_000216946.1.6568 WP_000216946.1.65689 WP_000216946.1.65693 WP_000216946.1.65700 WP_000216946.1.65703 WP_000216946.1.65705 WP_000216946.1.65713 WP_000216946.1.65734 WP_000216946.1.65769 WP_000216946.1.65809 WP_000216946.1.6585 WP_000216946.1.65856 WP_000216946.1.65892 WP_000216946.1.65922 WP_000216946.1.65931 WP_000216946.1.65935 WP_000216946.1.65947 WP_000216946.1.65948 WP_000216946.1.65965 WP_000216946.1.66009 WP_000216946.1.6603 WP_000216946.1.66054 WP_000216946.1.66069 WP_000216946.1.66081 WP_000216946.1.661 WP_000216946.1.6612 WP_000216946.1.66120 WP_000216946.1.66130 WP_000216946.1.66133 WP_000216946.1.66144 WP_000216946.1.66175 WP_000216946.1.66262 WP_000216946.1.66265 WP_000216946.1.66298 WP_000216946.1.66302 WP_000216946.1.6632 WP_000216946.1.66366 WP_000216946.1.66433 WP_000216946.1.66453 WP_000216946.1.66505 WP_000216946.1.66519 WP_000216946.1.66542 WP_000216946.1.66556 WP_000216946.1.66564 WP_000216946.1.66588 WP_000216946.1.66598 WP_000216946.1.66601 WP_000216946.1.66606 WP_000216946.1.66611 WP_000216946.1.66614 WP_000216946.1.6662 WP_000216946.1.66664 WP_000216946.1.66677 WP_000216946.1.66705 WP_000216946.1.66711 WP_000216946.1.6674 WP_000216946.1.66756 WP_000216946.1.66766 WP_000216946.1.66786 WP_000216946.1.66803 WP_000216946.1.66816 WP_000216946.1.66818 WP_000216946.1.6684 WP_000216946.1.66879 WP_000216946.1.6688 WP_000216946.1.66938 WP_000216946.1.66969 WP_000216946.1.67012 WP_000216946.1.67014 WP_000216946.1.67067 WP_000216946.1.67072 WP_000216946.1.67112 WP_000216946.1.67113 WP_000216946.1.67135 WP_000216946.1.67155 WP_000216946.1.67160 WP_000216946.1.67191 WP_000216946.1.6722 WP_000216946.1.67238 WP_000216946.1.67251 WP_000216946.1.67259 WP_000216946.1.6726 WP_000216946.1.67266 WP_000216946.1.67286 WP_000216946.1.67294 WP_000216946.1.67312 WP_000216946.1.67328 WP_000216946.1.67329 WP_000216946.1.67333 WP_000216946.1.67379 WP_000216946.1.6740 WP_000216946.1.67414 WP_000216946.1.67418 WP_000216946.1.67420 WP_000216946.1.67425 WP_000216946.1.67447 WP_000216946.1.67457 WP_000216946.1.67460 WP_000216946.1.67463 WP_000216946.1.67480 WP_000216946.1.67505 WP_000216946.1.67507 WP_000216946.1.67520 WP_000216946.1.67521 WP_000216946.1.67540 WP_000216946.1.67554 WP_000216946.1.67571 WP_000216946.1.67572 WP_000216946.1.67621 WP_000216946.1.67632 WP_000216946.1.67644 WP_000216946.1.67651 WP_000216946.1.67652 WP_000216946.1.67653 WP_000216946.1.67691 WP_000216946.1.67713 WP_000216946.1.67722 WP_000216946.1.67754 WP_000216946.1.67806 WP_000216946.1.67815 WP_000216946.1.67834 WP_000216946.1.6786 WP_000216946.1.67865 WP_000216946.1.67867 WP_000216946.1.67880 WP_000216946.1.67925 WP_000216946.1.67986 WP_000216946.1.67991 WP_000216946.1.68033 WP_000216946.1.68054 WP_000216946.1.68066 WP_000216946.1.68101 WP_000216946.1.6811 WP_000216946.1.68111 WP_000216946.1.68134 WP_000216946.1.68139 WP_000216946.1.68141 WP_000216946.1.68152 WP_000216946.1.68160 WP_000216946.1.68161 WP_000216946.1.68199 WP_000216946.1.68202 WP_000216946.1.68221 WP_000216946.1.68223 WP_000216946.1.6824 WP_000216946.1.68261 WP_000216946.1.68268 WP_000216946.1.68286 WP_000216946.1.68295 WP_000216946.1.68296 WP_000216946.1.68299 WP_000216946.1.6830 WP_000216946.1.68307 WP_000216946.1.6834 WP_000216946.1.68343 WP_000216946.1.68351 WP_000216946.1.68355 WP_000216946.1.68366 WP_000216946.1.68367 WP_000216946.1.6839 WP_000216946.1.68397 WP_000216946.1.68398 WP_000216946.1.68399 WP_000216946.1.68404 WP_000216946.1.68425 WP_000216946.1.68476 WP_000216946.1.68479 WP_000216946.1.68483 WP_000216946.1.68489 WP_000216946.1.68504 WP_000216946.1.68512 WP_000216946.1.68522 WP_000216946.1.68548 WP_000216946.1.68565 WP_000216946.1.686 WP_000216946.1.68636 WP_000216946.1.68650 WP_000216946.1.68681 WP_000216946.1.68683 WP_000216946.1.68699 WP_000216946.1.68703 WP_000216946.1.68728 WP_000216946.1.68737 WP_000216946.1.68741 WP_000216946.1.68743 WP_000216946.1.68775 WP_000216946.1.68813 WP_000216946.1.68831 WP_000216946.1.68854 WP_000216946.1.68864 WP_000216946.1.68875 WP_000216946.1.68883 WP_000216946.1.68943 WP_000216946.1.68944 WP_000216946.1.68998 WP_000216946.1.69012 WP_000216946.1.69045 WP_000216946.1.69071 WP_000216946.1.69078 WP_000216946.1.69087 WP_000216946.1.69089 WP_000216946.1.69105 WP_000216946.1.69147 WP_000216946.1.6915 WP_000216946.1.6917 WP_000216946.1.69191 WP_000216946.1.69198 WP_000216946.1.69213 WP_000216946.1.69219 WP_000216946.1.69222 WP_000216946.1.69237 WP_000216946.1.69239 WP_000216946.1.69349 WP_000216946.1.69366 WP_000216946.1.69394 WP_000216946.1.69395 WP_000216946.1.69415 WP_000216946.1.69437 WP_000216946.1.69475 WP_000216946.1.69476 WP_000216946.1.69480 WP_000216946.1.69490 WP_000216946.1.695 WP_000216946.1.6953 WP_000216946.1.69546 WP_000216946.1.69563 WP_000216946.1.69598 WP_000216946.1.69622 WP_000216946.1.69679 WP_000216946.1.6968 WP_000216946.1.69683 WP_000216946.1.69724 WP_000216946.1.6980 WP_000216946.1.69820 WP_000216946.1.69823 WP_000216946.1.69830 WP_000216946.1.69842 WP_000216946.1.69877 WP_000216946.1.69878 WP_000216946.1.69882 WP_000216946.1.699 WP_000216946.1.69902 WP_000216946.1.69921 WP_000216946.1.69934 WP_000216946.1.69980 WP_000216946.1.69987 WP_000216946.1.69995 WP_000216946.1.70024 WP_000216946.1.70048 WP_000216946.1.70059 WP_000216946.1.70105 WP_000216946.1.7012 WP_000216946.1.70133 WP_000216946.1.70161 WP_000216946.1.70210 WP_000216946.1.70220 WP_000216946.1.70225 WP_000216946.1.70228 WP_000216946.1.7024 WP_000216946.1.70253 WP_000216946.1.70273 WP_000216946.1.70294 WP_000216946.1.70311 WP_000216946.1.70313 WP_000216946.1.70334 WP_000216946.1.7034 WP_000216946.1.70344 WP_000216946.1.70349 WP_000216946.1.7043 WP_000216946.1.70448 WP_000216946.1.70451 WP_000216946.1.70459 WP_000216946.1.7046 WP_000216946.1.70462 WP_000216946.1.70487 WP_000216946.1.70495 WP_000216946.1.70527 WP_000216946.1.7053 WP_000216946.1.70546 WP_000216946.1.70554 WP_000216946.1.70558 WP_000216946.1.70564 WP_000216946.1.7061 WP_000216946.1.70635 WP_000216946.1.7064 WP_000216946.1.70641 WP_000216946.1.70664 WP_000216946.1.7067 WP_000216946.1.707 WP_000216946.1.70721 WP_000216946.1.7073 WP_000216946.1.70763 WP_000216946.1.70808 WP_000216946.1.70818 WP_000216946.1.70823 WP_000216946.1.70835 WP_000216946.1.70843 WP_000216946.1.70855 WP_000216946.1.70909 WP_000216946.1.70924 WP_000216946.1.70926 WP_000216946.1.70930 WP_000216946.1.70943 WP_000216946.1.710 WP_000216946.1.71016 WP_000216946.1.71043 WP_000216946.1.7105 WP_000216946.1.71058 WP_000216946.1.71059 WP_000216946.1.71073 WP_000216946.1.7109 WP_000216946.1.71130 WP_000216946.1.71182 WP_000216946.1.71196 WP_000216946.1.7120 WP_000216946.1.71208 WP_000216946.1.71231 WP_000216946.1.7125 WP_000216946.1.71257 WP_000216946.1.71267 WP_000216946.1.71295 WP_000216946.1.71298 WP_000216946.1.71313 WP_000216946.1.71325 WP_000216946.1.71345 WP_000216946.1.71359 WP_000216946.1.71410 WP_000216946.1.71416 WP_000216946.1.71463 WP_000216946.1.71467 WP_000216946.1.71475 WP_000216946.1.7150 WP_000216946.1.71519 WP_000216946.1.71529 WP_000216946.1.71543 WP_000216946.1.7158 WP_000216946.1.71596 WP_000216946.1.71602 WP_000216946.1.7161 WP_000216946.1.71662 WP_000216946.1.71676 WP_000216946.1.71715 WP_000216946.1.71721 WP_000216946.1.71735 WP_000216946.1.71737 WP_000216946.1.71739 WP_000216946.1.71780 WP_000216946.1.7179 WP_000216946.1.71861 WP_000216946.1.71877 WP_000216946.1.71892 WP_000216946.1.71899 WP_000216946.1.71910 WP_000216946.1.71925 WP_000216946.1.71978 WP_000216946.1.71989 WP_000216946.1.72002 WP_000216946.1.72018 WP_000216946.1.72026 WP_000216946.1.72031 WP_000216946.1.72067 WP_000216946.1.72085 WP_000216946.1.72148 WP_000216946.1.72169 WP_000216946.1.72176 WP_000216946.1.722 WP_000216946.1.72204 WP_000216946.1.72205 WP_000216946.1.72271 WP_000216946.1.72306 WP_000216946.1.72330 WP_000216946.1.72340 WP_000216946.1.72347 WP_000216946.1.7236 WP_000216946.1.72363 WP_000216946.1.72366 WP_000216946.1.72371 WP_000216946.1.72424 WP_000216946.1.72453 WP_000216946.1.72465 WP_000216946.1.72478 WP_000216946.1.72497 WP_000216946.1.7254 WP_000216946.1.72547 WP_000216946.1.72564 WP_000216946.1.7258 WP_000216946.1.7260 WP_000216946.1.72626 WP_000216946.1.72649 WP_000216946.1.72654 WP_000216946.1.72666 WP_000216946.1.72708 WP_000216946.1.72719 WP_000216946.1.72753 WP_000216946.1.72762 WP_000216946.1.72787 WP_000216946.1.72816 WP_000216946.1.72832 WP_000216946.1.72834 WP_000216946.1.72835 WP_000216946.1.72881 WP_000216946.1.72903 WP_000216946.1.72904 WP_000216946.1.72930 WP_000216946.1.72935 WP_000216946.1.72945 WP_000216946.1.72961 WP_000216946.1.72991 WP_000216946.1.73002 WP_000216946.1.73017 WP_000216946.1.73019 WP_000216946.1.73021 WP_000216946.1.73022 WP_000216946.1.73037 WP_000216946.1.73087 WP_000216946.1.73122 WP_000216946.1.73132 WP_000216946.1.73140 WP_000216946.1.73190 WP_000216946.1.73201 WP_000216946.1.73211 WP_000216946.1.73240 WP_000216946.1.73241 WP_000216946.1.73246 WP_000216946.1.73264 WP_000216946.1.73265 WP_000216946.1.73286 WP_000216946.1.73386 WP_000216946.1.73401 WP_000216946.1.73420 WP_000216946.1.73444 WP_000216946.1.73450 WP_000216946.1.73456 WP_000216946.1.73464 WP_000216946.1.73501 WP_000216946.1.73513 WP_000216946.1.73539 WP_000216946.1.73571 WP_000216946.1.736 WP_000216946.1.7360 WP_000216946.1.73610 WP_000216946.1.73639 WP_000216946.1.7365 WP_000216946.1.73674 WP_000216946.1.73685 WP_000216946.1.73735 WP_000216946.1.73759 WP_000216946.1.73786 WP_000216946.1.73789 WP_000216946.1.7380 WP_000216946.1.73834 WP_000216946.1.73858 WP_000216946.1.73868 WP_000216946.1.73885 WP_000216946.1.73900 WP_000216946.1.73910 WP_000216946.1.73920 WP_000216946.1.73921 WP_000216946.1.73940 WP_000216946.1.73949 WP_000216946.1.73961 WP_000216946.1.73969 WP_000216946.1.73971 WP_000216946.1.73976 WP_000216946.1.73983 WP_000216946.1.74004 WP_000216946.1.74006 WP_000216946.1.7401 WP_000216946.1.74010 WP_000216946.1.74027 WP_000216946.1.7406 WP_000216946.1.74073 WP_000216946.1.74081 WP_000216946.1.74085 WP_000216946.1.74157 WP_000216946.1.74161 WP_000216946.1.74172 WP_000216946.1.74173 WP_000216946.1.74183 WP_000216946.1.74216 WP_000216946.1.74234 WP_000216946.1.74237 WP_000216946.1.74257 WP_000216946.1.7427 WP_000216946.1.74273 WP_000216946.1.74284 WP_000216946.1.74295 WP_000216946.1.74327 WP_000216946.1.7434 WP_000216946.1.74353 WP_000216946.1.74356 WP_000216946.1.74380 WP_000216946.1.74429 WP_000216946.1.74456 WP_000216946.1.74457 WP_000216946.1.74468 WP_000216946.1.74533 WP_000216946.1.7457 WP_000216946.1.74576 WP_000216946.1.74587 WP_000216946.1.74610 WP_000216946.1.74638 WP_000216946.1.74676 WP_000216946.1.74681 WP_000216946.1.74696 WP_000216946.1.74704 WP_000216946.1.74731 WP_000216946.1.74747 WP_000216946.1.74758 WP_000216946.1.74761 WP_000216946.1.74770 WP_000216946.1.74785 WP_000216946.1.74797 WP_000216946.1.74802 WP_000216946.1.7482 WP_000216946.1.74840 WP_000216946.1.74846 WP_000216946.1.74866 WP_000216946.1.74874 WP_000216946.1.74890 WP_000216946.1.74911 WP_000216946.1.74922 WP_000216946.1.74924 WP_000216946.1.74961 WP_000216946.1.74994 WP_000216946.1.74999 WP_000216946.1.75038 WP_000216946.1.75044 WP_000216946.1.75048 WP_000216946.1.75052 WP_000216946.1.75070 WP_000216946.1.75093 WP_000216946.1.75111 WP_000216946.1.75131 WP_000216946.1.75132 WP_000216946.1.75141 WP_000216946.1.75186 WP_000216946.1.75227 WP_000216946.1.75252 WP_000216946.1.75253 WP_000216946.1.75294 WP_000216946.1.75298 WP_000216946.1.75320 WP_000216946.1.75323 WP_000216946.1.75327 WP_000216946.1.75349 WP_000216946.1.75351 WP_000216946.1.75356 WP_000216946.1.75365 WP_000216946.1.75399 WP_000216946.1.75409 WP_000216946.1.7542 WP_000216946.1.75438 WP_000216946.1.75440 WP_000216946.1.75527 WP_000216946.1.75538 WP_000216946.1.75551 WP_000216946.1.75566 WP_000216946.1.75571 WP_000216946.1.7561 WP_000216946.1.75647 WP_000216946.1.75649 WP_000216946.1.75652 WP_000216946.1.75685 WP_000216946.1.75692 WP_000216946.1.75728 WP_000216946.1.75743 WP_000216946.1.75769 WP_000216946.1.75775 WP_000216946.1.758 WP_000216946.1.75800 WP_000216946.1.75809 WP_000216946.1.75830 WP_000216946.1.75840 WP_000216946.1.75848 WP_000216946.1.75862 WP_000216946.1.75881 WP_000216946.1.75885 WP_000216946.1.75910 WP_000216946.1.75929 WP_000216946.1.75952 WP_000216946.1.7596 WP_000216946.1.75969 WP_000216946.1.76010 WP_000216946.1.76013 WP_000216946.1.76015 WP_000216946.1.7602 WP_000216946.1.76047 WP_000216946.1.76049 WP_000216946.1.76050 WP_000216946.1.76053 WP_000216946.1.76095 WP_000216946.1.76111 WP_000216946.1.76114 WP_000216946.1.76121 WP_000216946.1.76143 WP_000216946.1.76149 WP_000216946.1.76153 WP_000216946.1.76179 WP_000216946.1.76230 WP_000216946.1.76234 WP_000216946.1.7624 WP_000216946.1.7625 WP_000216946.1.76258 WP_000216946.1.76261 WP_000216946.1.7627 WP_000216946.1.76282 WP_000216946.1.76283 WP_000216946.1.76313 WP_000216946.1.76332 WP_000216946.1.76337 WP_000216946.1.76351 WP_000216946.1.76419 WP_000216946.1.76421 WP_000216946.1.76424 WP_000216946.1.76426 WP_000216946.1.76431 WP_000216946.1.76463 WP_000216946.1.76497 WP_000216946.1.7658 WP_000216946.1.76606 WP_000216946.1.76624 WP_000216946.1.76648 WP_000216946.1.76674 WP_000216946.1.76686 WP_000216946.1.76690 WP_000216946.1.76693 WP_000216946.1.76711 WP_000216946.1.76718 WP_000216946.1.7675 WP_000216946.1.76790 WP_000216946.1.76792 WP_000216946.1.76798 WP_000216946.1.768 WP_000216946.1.76803 WP_000216946.1.76816 WP_000216946.1.76820 WP_000216946.1.76829 WP_000216946.1.76839 WP_000216946.1.76845 WP_000216946.1.76897 WP_000216946.1.76921 WP_000216946.1.7694 WP_000216946.1.76944 WP_000216946.1.76952 WP_000216946.1.76998 WP_000216946.1.77031 WP_000216946.1.77041 WP_000216946.1.77043 WP_000216946.1.77050 WP_000216946.1.77060 WP_000216946.1.77062 WP_000216946.1.77072 WP_000216946.1.77112 WP_000216946.1.77137 WP_000216946.1.77145 WP_000216946.1.77158 WP_000216946.1.77187 WP_000216946.1.77190 WP_000216946.1.77203 WP_000216946.1.77229 WP_000216946.1.77297 WP_000216946.1.77298 WP_000216946.1.77305 WP_000216946.1.77331 WP_000216946.1.77346 WP_000216946.1.77359 WP_000216946.1.77388 WP_000216946.1.77426 WP_000216946.1.7745 WP_000216946.1.77460 WP_000216946.1.77485 WP_000216946.1.77489 WP_000216946.1.77497 WP_000216946.1.77498 WP_000216946.1.7752 WP_000216946.1.77520 WP_000216946.1.77527 WP_000216946.1.77532 WP_000216946.1.77533 WP_000216946.1.77536 WP_000216946.1.77572 WP_000216946.1.77603 WP_000216946.1.77606 WP_000216946.1.77650 WP_000216946.1.77735 WP_000216946.1.77738 WP_000216946.1.7774 WP_000216946.1.77743 WP_000216946.1.77791 WP_000216946.1.77818 WP_000216946.1.77848 WP_000216946.1.7785 WP_000216946.1.77858 WP_000216946.1.7786 WP_000216946.1.7787 WP_000216946.1.77882 WP_000216946.1.77915 WP_000216946.1.77922 WP_000216946.1.77930 WP_000216946.1.77957 WP_000216946.1.77986 WP_000216946.1.78038 WP_000216946.1.78054 WP_000216946.1.78082 WP_000216946.1.78091 WP_000216946.1.78093 WP_000216946.1.7810 WP_000216946.1.78164 WP_000216946.1.78173 WP_000216946.1.78179 WP_000216946.1.78189 WP_000216946.1.78194 WP_000216946.1.78207 WP_000216946.1.78208 WP_000216946.1.78252 WP_000216946.1.78254 WP_000216946.1.78257 WP_000216946.1.7827 WP_000216946.1.78304 WP_000216946.1.78311 WP_000216946.1.78330 WP_000216946.1.78332 WP_000216946.1.78335 WP_000216946.1.78365 WP_000216946.1.78371 WP_000216946.1.78404 WP_000216946.1.78434 WP_000216946.1.78436 WP_000216946.1.78470 WP_000216946.1.78489 WP_000216946.1.78494 WP_000216946.1.7850 WP_000216946.1.7853 WP_000216946.1.78558 WP_000216946.1.7857 WP_000216946.1.78573 WP_000216946.1.78585 WP_000216946.1.78592 WP_000216946.1.78598 WP_000216946.1.78604 WP_000216946.1.78653 WP_000216946.1.78662 WP_000216946.1.78667 WP_000216946.1.78685 WP_000216946.1.78728 WP_000216946.1.78736 WP_000216946.1.78758 WP_000216946.1.78763 WP_000216946.1.78803 WP_000216946.1.78816 WP_000216946.1.78819 WP_000216946.1.78841 WP_000216946.1.78897 WP_000216946.1.78937 WP_000216946.1.78946 WP_000216946.1.78983 WP_000216946.1.78985 WP_000216946.1.78991 WP_000216946.1.78995 WP_000216946.1.7900 WP_000216946.1.79006 WP_000216946.1.79038 WP_000216946.1.7905 WP_000216946.1.79051 WP_000216946.1.79085 WP_000216946.1.79110 WP_000216946.1.79131 WP_000216946.1.7914 WP_000216946.1.79143 WP_000216946.1.79170 WP_000216946.1.79178 WP_000216946.1.79192 WP_000216946.1.79197 WP_000216946.1.79208 WP_000216946.1.79223 WP_000216946.1.79275 WP_000216946.1.79285 WP_000216946.1.7931 WP_000216946.1.79310 WP_000216946.1.79314 WP_000216946.1.79322 WP_000216946.1.79332 WP_000216946.1.79367 WP_000216946.1.79374 WP_000216946.1.79378 WP_000216946.1.79408 WP_000216946.1.79436 WP_000216946.1.79461 WP_000216946.1.79476 WP_000216946.1.79487 WP_000216946.1.79539 WP_000216946.1.79552 WP_000216946.1.79556 WP_000216946.1.79581 WP_000216946.1.79626 WP_000216946.1.79627 WP_000216946.1.79662 WP_000216946.1.79672 WP_000216946.1.79676 WP_000216946.1.79677 WP_000216946.1.79706 WP_000216946.1.79731 WP_000216946.1.79763 WP_000216946.1.7981 WP_000216946.1.79815 WP_000216946.1.79822 WP_000216946.1.79831 WP_000216946.1.79834 WP_000216946.1.79837 WP_000216946.1.79896 WP_000216946.1.79904 WP_000216946.1.79911 WP_000216946.1.7992 WP_000216946.1.79941 WP_000216946.1.79961 WP_000216946.1.79971 WP_000216946.1.79991 WP_000216946.1.80000 WP_000216946.1.80009 WP_000216946.1.80013 WP_000216946.1.80029 WP_000216946.1.80032 WP_000216946.1.80042 WP_000216946.1.80079 WP_000216946.1.80086 WP_000216946.1.80109 WP_000216946.1.80119 WP_000216946.1.80120 WP_000216946.1.80122 WP_000216946.1.80127 WP_000216946.1.80146 WP_000216946.1.80178 WP_000216946.1.80184 WP_000216946.1.80203 WP_000216946.1.80210 WP_000216946.1.80244 WP_000216946.1.80274 WP_000216946.1.80287 WP_000216946.1.80290 WP_000216946.1.8031 WP_000216946.1.80316 WP_000216946.1.8035 WP_000216946.1.80358 WP_000216946.1.80378 WP_000216946.1.80389 WP_000216946.1.8040 WP_000216946.1.8043 WP_000216946.1.80434 WP_000216946.1.8045 WP_000216946.1.80472 WP_000216946.1.80521 WP_000216946.1.80530 WP_000216946.1.80582 WP_000216946.1.8065 WP_000216946.1.80653 WP_000216946.1.80687 WP_000216946.1.80717 WP_000216946.1.80745 WP_000216946.1.80761 WP_000216946.1.80763 WP_000216946.1.80781 WP_000216946.1.80786 WP_000216946.1.80833 WP_000216946.1.8084 WP_000216946.1.80855 WP_000216946.1.80872 WP_000216946.1.80899 WP_000216946.1.80962 WP_000216946.1.81010 WP_000216946.1.81022 WP_000216946.1.81049 WP_000216946.1.81052 WP_000216946.1.81064 WP_000216946.1.81085 WP_000216946.1.81095 WP_000216946.1.81097 WP_000216946.1.81114 WP_000216946.1.81132 WP_000216946.1.81151 WP_000216946.1.81157 WP_000216946.1.81171 WP_000216946.1.81172 WP_000216946.1.81176 WP_000216946.1.81184 WP_000216946.1.81214 WP_000216946.1.81228 WP_000216946.1.81232 WP_000216946.1.81234 WP_000216946.1.8125 WP_000216946.1.81252 WP_000216946.1.81288 WP_000216946.1.81290 WP_000216946.1.81344 WP_000216946.1.8135 WP_000216946.1.81379 WP_000216946.1.81384 WP_000216946.1.81385 WP_000216946.1.81389 WP_000216946.1.8142 WP_000216946.1.8144 WP_000216946.1.81464 WP_000216946.1.81467 WP_000216946.1.81508 WP_000216946.1.81574 WP_000216946.1.81599 WP_000216946.1.8160 WP_000216946.1.81604 WP_000216946.1.81610 WP_000216946.1.81619 WP_000216946.1.81645 WP_000216946.1.81718 WP_000216946.1.81740 WP_000216946.1.81758 WP_000216946.1.81767 WP_000216946.1.8180 WP_000216946.1.81800 WP_000216946.1.81810 WP_000216946.1.81812 WP_000216946.1.81831 WP_000216946.1.81837 WP_000216946.1.81838 WP_000216946.1.8185 WP_000216946.1.81861 WP_000216946.1.81870 WP_000216946.1.81897 WP_000216946.1.81903 WP_000216946.1.81905 WP_000216946.1.81906 WP_000216946.1.81919 WP_000216946.1.81944 WP_000216946.1.81955 WP_000216946.1.81969 WP_000216946.1.81999 WP_000216946.1.82009 WP_000216946.1.82053 WP_000216946.1.8206 WP_000216946.1.82103 WP_000216946.1.8212 WP_000216946.1.82121 WP_000216946.1.8213 WP_000216946.1.82174 WP_000216946.1.82184 WP_000216946.1.82219 WP_000216946.1.82247 WP_000216946.1.82253 WP_000216946.1.82259 WP_000216946.1.82278 WP_000216946.1.82281 WP_000216946.1.82301 WP_000216946.1.82340 WP_000216946.1.82349 WP_000216946.1.82354 WP_000216946.1.82358 WP_000216946.1.82368 WP_000216946.1.82406 WP_000216946.1.82447 WP_000216946.1.82458 WP_000216946.1.8246 WP_000216946.1.82467 WP_000216946.1.82468 WP_000216946.1.82525 WP_000216946.1.82548 WP_000216946.1.82558 WP_000216946.1.82612 WP_000216946.1.8265 WP_000216946.1.8266 WP_000216946.1.82678 WP_000216946.1.82709 WP_000216946.1.82724 WP_000216946.1.82768 WP_000216946.1.82796 WP_000216946.1.8280 WP_000216946.1.82802 WP_000216946.1.82824 WP_000216946.1.82829 WP_000216946.1.82855 WP_000216946.1.82862 WP_000216946.1.8289 WP_000216946.1.82930 WP_000216946.1.82941 WP_000216946.1.82976 WP_000216946.1.82980 WP_000216946.1.83046 WP_000216946.1.83054 WP_000216946.1.83066 WP_000216946.1.83078 WP_000216946.1.83086 WP_000216946.1.83103 WP_000216946.1.83152 WP_000216946.1.83153 WP_000216946.1.8318 WP_000216946.1.83185 WP_000216946.1.83193 WP_000216946.1.83203 WP_000216946.1.83234 WP_000216946.1.83291 WP_000216946.1.83316 WP_000216946.1.83352 WP_000216946.1.83359 WP_000216946.1.83372 WP_000216946.1.83405 WP_000216946.1.83417 WP_000216946.1.83418 WP_000216946.1.8346 WP_000216946.1.83467 WP_000216946.1.83472 WP_000216946.1.83476 WP_000216946.1.83484 WP_000216946.1.83508 WP_000216946.1.83517 WP_000216946.1.83520 WP_000216946.1.83593 WP_000216946.1.83646 WP_000216946.1.83652 WP_000216946.1.83653 WP_000216946.1.8366 WP_000216946.1.83674 WP_000216946.1.83676 WP_000216946.1.83720 WP_000216946.1.83728 WP_000216946.1.83750 WP_000216946.1.83756 WP_000216946.1.83758 WP_000216946.1.83763 WP_000216946.1.83769 WP_000216946.1.83770 WP_000216946.1.83775 WP_000216946.1.83788 WP_000216946.1.83797 WP_000216946.1.83804 WP_000216946.1.83825 WP_000216946.1.8383 WP_000216946.1.8385 WP_000216946.1.83864 WP_000216946.1.83865 WP_000216946.1.83881 WP_000216946.1.83886 WP_000216946.1.83912 WP_000216946.1.83919 WP_000216946.1.83928 WP_000216946.1.83955 WP_000216946.1.83984 WP_000216946.1.83989 WP_000216946.1.84010 WP_000216946.1.84025 WP_000216946.1.84049 WP_000216946.1.84054 WP_000216946.1.84064 WP_000216946.1.84118 WP_000216946.1.84129 WP_000216946.1.84144 WP_000216946.1.84161 WP_000216946.1.84163 WP_000216946.1.84188 WP_000216946.1.84275 WP_000216946.1.84293 WP_000216946.1.84342 WP_000216946.1.84414 WP_000216946.1.84415 WP_000216946.1.84418 WP_000216946.1.84442 WP_000216946.1.84445 WP_000216946.1.84451 WP_000216946.1.84508 WP_000216946.1.84509 WP_000216946.1.84563 WP_000216946.1.84578 WP_000216946.1.84590 WP_000216946.1.84596 WP_000216946.1.84608 WP_000216946.1.8462 WP_000216946.1.84625 WP_000216946.1.84638 WP_000216946.1.84648 WP_000216946.1.8468 WP_000216946.1.84682 WP_000216946.1.84696 WP_000216946.1.8475 WP_000216946.1.84752 WP_000216946.1.84757 WP_000216946.1.84761 WP_000216946.1.84815 WP_000216946.1.84826 WP_000216946.1.84847 WP_000216946.1.84854 WP_000216946.1.84889 WP_000216946.1.84903 WP_000216946.1.84907 WP_000216946.1.84922 WP_000216946.1.84924 WP_000216946.1.8493 WP_000216946.1.8496 WP_000216946.1.84975 WP_000216946.1.85017 WP_000216946.1.85022 WP_000216946.1.85026 WP_000216946.1.85045 WP_000216946.1.85047 WP_000216946.1.85056 WP_000216946.1.85070 WP_000216946.1.85081 WP_000216946.1.85099 WP_000216946.1.85118 WP_000216946.1.85132 WP_000216946.1.85135 WP_000216946.1.85151 WP_000216946.1.85160 WP_000216946.1.85213 WP_000216946.1.85226 WP_000216946.1.85229 WP_000216946.1.85231 WP_000216946.1.85235 WP_000216946.1.85238 WP_000216946.1.85289 WP_000216946.1.85292 WP_000216946.1.85351 WP_000216946.1.85375 WP_000216946.1.85376 WP_000216946.1.85383 WP_000216946.1.85395 WP_000216946.1.85404 WP_000216946.1.85409 WP_000216946.1.85441 WP_000216946.1.85445 WP_000216946.1.85462 WP_000216946.1.85471 WP_000216946.1.85474 WP_000216946.1.85485 WP_000216946.1.85492 WP_000216946.1.85506 WP_000216946.1.8551 WP_000216946.1.85515 WP_000216946.1.85519 WP_000216946.1.85547 WP_000216946.1.85555 WP_000216946.1.85585 WP_000216946.1.85586 WP_000216946.1.85596 WP_000216946.1.85611 WP_000216946.1.85649 WP_000216946.1.85730 WP_000216946.1.85732 WP_000216946.1.85758 WP_000216946.1.85795 WP_000216946.1.85796 WP_000216946.1.85816 WP_000216946.1.85834 WP_000216946.1.85858 WP_000216946.1.85873 WP_000216946.1.85906 WP_000216946.1.85924 WP_000216946.1.85927 WP_000216946.1.85950 WP_000216946.1.85971 WP_000216946.1.85980 WP_000216946.1.85993 WP_000216946.1.86018 WP_000216946.1.86036 WP_000216946.1.86042 WP_000216946.1.86072 WP_000216946.1.86086 WP_000216946.1.86123 WP_000216946.1.86144 WP_000216946.1.86154 WP_000216946.1.86158 WP_000216946.1.8617 WP_000216946.1.86188 WP_000216946.1.862 WP_000216946.1.86207 WP_000216946.1.86209 WP_000216946.1.86248 WP_000216946.1.8627 WP_000216946.1.86270 WP_000216946.1.86281 WP_000216946.1.86304 WP_000216946.1.86315 WP_000216946.1.86344 WP_000216946.1.86363 WP_000216946.1.86367 WP_000216946.1.86378 WP_000216946.1.8643 WP_000216946.1.86439 WP_000216946.1.86473 WP_000216946.1.86482 WP_000216946.1.86523 WP_000216946.1.86531 WP_000216946.1.86542 WP_000216946.1.86606 WP_000216946.1.86628 WP_000216946.1.86664 WP_000216946.1.86704 WP_000216946.1.86706 WP_000216946.1.86736 WP_000216946.1.86745 WP_000216946.1.86779 WP_000216946.1.86792 WP_000216946.1.86793 WP_000216946.1.86795 WP_000216946.1.8681 WP_000216946.1.86838 WP_000216946.1.8690 WP_000216946.1.86911 WP_000216946.1.86940 WP_000216946.1.86942 WP_000216946.1.86961 WP_000216946.1.86968 WP_000216946.1.86977 WP_000216946.1.86999 WP_000216946.1.87021 WP_000216946.1.87042 WP_000216946.1.87057 WP_000216946.1.87072 WP_000216946.1.87088 WP_000216946.1.87090 WP_000216946.1.87097 WP_000216946.1.87100 WP_000216946.1.87119 WP_000216946.1.8712 WP_000216946.1.87122 WP_000216946.1.87133 WP_000216946.1.87137 WP_000216946.1.87141 WP_000216946.1.87168 WP_000216946.1.87175 WP_000216946.1.87190 WP_000216946.1.87194 WP_000216946.1.8720 WP_000216946.1.87204 WP_000216946.1.87221 WP_000216946.1.87260 WP_000216946.1.87261 WP_000216946.1.87272 WP_000216946.1.87285 WP_000216946.1.87290 WP_000216946.1.87296 WP_000216946.1.8731 WP_000216946.1.87363 WP_000216946.1.87372 WP_000216946.1.87388 WP_000216946.1.87396 WP_000216946.1.87457 WP_000216946.1.87461 WP_000216946.1.87466 WP_000216946.1.87486 WP_000216946.1.875 WP_000216946.1.87508 WP_000216946.1.87511 WP_000216946.1.87515 WP_000216946.1.8753 WP_000216946.1.87541 WP_000216946.1.87543 WP_000216946.1.87595 WP_000216946.1.8764 WP_000216946.1.87710 WP_000216946.1.87718 WP_000216946.1.87734 WP_000216946.1.87745 WP_000216946.1.87748 WP_000216946.1.87764 WP_000216946.1.8779 WP_000216946.1.87808 WP_000216946.1.87828 WP_000216946.1.87838 WP_000216946.1.87841 WP_000216946.1.87854 WP_000216946.1.87865 WP_000216946.1.87879 WP_000216946.1.8791 WP_000216946.1.87912 WP_000216946.1.87963 WP_000216946.1.87967 WP_000216946.1.87972 WP_000216946.1.88013 WP_000216946.1.88032 WP_000216946.1.88061 WP_000216946.1.88114 WP_000216946.1.88150 WP_000216946.1.88169 WP_000216946.1.88270 WP_000216946.1.88309 WP_000216946.1.88311 WP_000216946.1.88317 WP_000216946.1.88319 WP_000216946.1.88351 WP_000216946.1.88367 WP_000216946.1.88371 WP_000216946.1.88375 WP_000216946.1.88380 WP_000216946.1.88418 WP_000216946.1.88430 WP_000216946.1.88440 WP_000216946.1.88449 WP_000216946.1.8847 WP_000216946.1.88473 WP_000216946.1.88480 WP_000216946.1.88498 WP_000216946.1.88518 WP_000216946.1.88555 WP_000216946.1.88558 WP_000216946.1.88560 WP_000216946.1.88563 WP_000216946.1.8857 WP_000216946.1.88580 WP_000216946.1.8859 WP_000216946.1.88599 WP_000216946.1.88600 WP_000216946.1.88614 WP_000216946.1.88623 WP_000216946.1.88636 WP_000216946.1.88642 WP_000216946.1.88671 WP_000216946.1.88696 WP_000216946.1.8872 WP_000216946.1.88739 WP_000216946.1.88753 WP_000216946.1.88761 WP_000216946.1.88771 WP_000216946.1.88781 WP_000216946.1.88843 WP_000216946.1.88856 WP_000216946.1.88859 WP_000216946.1.8886 WP_000216946.1.88878 WP_000216946.1.8888 WP_000216946.1.88897 WP_000216946.1.88922 WP_000216946.1.88934 WP_000216946.1.88954 WP_000216946.1.88960 WP_000216946.1.88962 WP_000216946.1.8899 WP_000216946.1.8900 WP_000216946.1.89012 WP_000216946.1.89024 WP_000216946.1.89036 WP_000216946.1.89086 WP_000216946.1.8913 WP_000216946.1.89133 WP_000216946.1.89164 WP_000216946.1.8918 WP_000216946.1.89181 WP_000216946.1.89184 WP_000216946.1.89194 WP_000216946.1.89195 WP_000216946.1.89204 WP_000216946.1.8924 WP_000216946.1.89258 WP_000216946.1.89262 WP_000216946.1.89284 WP_000216946.1.89290 WP_000216946.1.89348 WP_000216946.1.89350 WP_000216946.1.89390 WP_000216946.1.89404 WP_000216946.1.89433 WP_000216946.1.89516 WP_000216946.1.89537 WP_000216946.1.89544 WP_000216946.1.89545 WP_000216946.1.89559 WP_000216946.1.89655 WP_000216946.1.89672 WP_000216946.1.89678 WP_000216946.1.897 WP_000216946.1.89726 WP_000216946.1.89730 WP_000216946.1.89754 WP_000216946.1.89779 WP_000216946.1.89794 WP_000216946.1.89857 WP_000216946.1.8986 WP_000216946.1.89863 WP_000216946.1.89883 WP_000216946.1.89908 WP_000216946.1.89949 WP_000216946.1.89950 WP_000216946.1.90005 WP_000216946.1.90018 WP_000216946.1.90038 WP_000216946.1.90046 WP_000216946.1.90055 WP_000216946.1.90069 WP_000216946.1.90091 WP_000216946.1.90131 WP_000216946.1.90148 WP_000216946.1.90161 WP_000216946.1.90173 WP_000216946.1.90174 WP_000216946.1.90180 WP_000216946.1.90215 WP_000216946.1.90217 WP_000216946.1.9022 WP_000216946.1.90243 WP_000216946.1.90246 WP_000216946.1.90250 WP_000216946.1.90253 WP_000216946.1.90276 WP_000216946.1.9030 WP_000216946.1.90331 WP_000216946.1.90367 WP_000216946.1.90386 WP_000216946.1.90447 WP_000216946.1.90454 WP_000216946.1.90473 WP_000216946.1.90475 WP_000216946.1.90488 WP_000216946.1.90506 WP_000216946.1.90517 WP_000216946.1.90533 WP_000216946.1.90544 WP_000216946.1.9055 WP_000216946.1.90554 WP_000216946.1.90556 WP_000216946.1.90604 WP_000216946.1.90647 WP_000216946.1.90660 WP_000216946.1.90683 WP_000216946.1.90698 WP_000216946.1.9071 WP_000216946.1.90726 WP_000216946.1.90728 WP_000216946.1.90745 WP_000216946.1.9076 WP_000216946.1.90801 WP_000216946.1.90804 WP_000216946.1.90861 WP_000216946.1.90896 WP_000216946.1.90903 WP_000216946.1.90923 WP_000216946.1.9100 WP_000216946.1.91005 WP_000216946.1.91011 WP_000216946.1.91019 WP_000216946.1.91054 WP_000216946.1.91124 WP_000216946.1.91126 WP_000216946.1.9114 WP_000216946.1.91150 WP_000216946.1.91158 WP_000216946.1.91177 WP_000216946.1.912 WP_000216946.1.9122 WP_000216946.1.91233 WP_000216946.1.91246 WP_000216946.1.91258 WP_000216946.1.91279 WP_000216946.1.91280 WP_000216946.1.91287 WP_000216946.1.91300 WP_000216946.1.91332 WP_000216946.1.91346 WP_000216946.1.91357 WP_000216946.1.91364 WP_000216946.1.91371 WP_000216946.1.91382 WP_000216946.1.9140 WP_000216946.1.91420 WP_000216946.1.91427 WP_000216946.1.91447 WP_000216946.1.91486 WP_000216946.1.91487 WP_000216946.1.91500 WP_000216946.1.91525 WP_000216946.1.91530 WP_000216946.1.9155 WP_000216946.1.91559 WP_000216946.1.91573 WP_000216946.1.91581 WP_000216946.1.91586 WP_000216946.1.91587 WP_000216946.1.91611 WP_000216946.1.91634 WP_000216946.1.91639 WP_000216946.1.91670 WP_000216946.1.917 WP_000216946.1.91745 WP_000216946.1.91749 WP_000216946.1.91771 WP_000216946.1.91791 WP_000216946.1.91800 WP_000216946.1.91816 WP_000216946.1.91829 WP_000216946.1.91848 WP_000216946.1.91895 WP_000216946.1.91918 WP_000216946.1.91928 WP_000216946.1.91950 WP_000216946.1.91969 WP_000216946.1.92 WP_000216946.1.92055 WP_000216946.1.92080 WP_000216946.1.92115 WP_000216946.1.92125 WP_000216946.1.92133 WP_000216946.1.92140 WP_000216946.1.92143 WP_000216946.1.92164 WP_000216946.1.92169 WP_000216946.1.92173 WP_000216946.1.92185 WP_000216946.1.92186 WP_000216946.1.92196 WP_000216946.1.92212 WP_000216946.1.92227 WP_000216946.1.92228 WP_000216946.1.9224 WP_000216946.1.92244 WP_000216946.1.92253 WP_000216946.1.92254 WP_000216946.1.923 WP_000216946.1.92303 WP_000216946.1.9234 WP_000216946.1.9239 WP_000216946.1.92391 WP_000216946.1.92405 WP_000216946.1.92415 WP_000216946.1.92425 WP_000216946.1.92436 WP_000216946.1.92442 WP_000216946.1.9247 WP_000216946.1.92488 WP_000216946.1.92497 WP_000216946.1.92500 WP_000216946.1.92512 WP_000216946.1.92520 WP_000216946.1.92534 WP_000216946.1.92565 WP_000216946.1.92607 WP_000216946.1.92667 WP_000216946.1.92674 WP_000216946.1.92679 WP_000216946.1.92691 WP_000216946.1.92718 WP_000216946.1.92723 WP_000216946.1.92735 WP_000216946.1.92741 WP_000216946.1.92765 WP_000216946.1.92773 WP_000216946.1.92789 WP_000216946.1.92795 WP_000216946.1.92805 WP_000216946.1.92862 WP_000216946.1.92864 WP_000216946.1.92950 WP_000216946.1.9296 WP_000216946.1.92960 WP_000216946.1.92965 WP_000216946.1.92997 WP_000216946.1.93047 WP_000216946.1.93071 WP_000216946.1.93074 WP_000216946.1.93125 WP_000216946.1.93147 WP_000216946.1.93163 WP_000216946.1.93176 WP_000216946.1.93191 WP_000216946.1.93197 WP_000216946.1.93211 WP_000216946.1.93224 WP_000216946.1.93237 WP_000216946.1.93243 WP_000216946.1.93254 WP_000216946.1.93260 WP_000216946.1.93272 WP_000216946.1.93296 WP_000216946.1.93300 WP_000216946.1.93336 WP_000216946.1.93378 WP_000216946.1.93416 WP_000216946.1.93438 WP_000216946.1.93444 WP_000216946.1.93471 WP_000216946.1.93514 WP_000216946.1.9352 WP_000216946.1.9354 WP_000216946.1.93567 WP_000216946.1.93579 WP_000216946.1.9358 WP_000216946.1.93590 WP_000216946.1.93658 WP_000216946.1.93678 WP_000216946.1.93708 WP_000216946.1.93710 WP_000216946.1.93722 WP_000216946.1.93736 WP_000216946.1.93738 WP_000216946.1.93758 WP_000216946.1.93762 WP_000216946.1.93769 WP_000216946.1.93775 WP_000216946.1.93787 WP_000216946.1.9387 WP_000216946.1.93882 WP_000216946.1.93883 WP_000216946.1.93890 WP_000216946.1.93891 WP_000216946.1.93976 WP_000216946.1.9398 WP_000216946.1.94 WP_000216946.1.94074 WP_000216946.1.94080 WP_000216946.1.94082 WP_000216946.1.94087 WP_000216946.1.94096 WP_000216946.1.94119 WP_000216946.1.94122 WP_000216946.1.94123 WP_000216946.1.94130 WP_000216946.1.94165 WP_000216946.1.94172 WP_000216946.1.94242 WP_000216946.1.94245 WP_000216946.1.94248 WP_000216946.1.94268 WP_000216946.1.94287 WP_000216946.1.94293 WP_000216946.1.94294 WP_000216946.1.9430 WP_000216946.1.94320 WP_000216946.1.94324 WP_000216946.1.94335 WP_000216946.1.94340 WP_000216946.1.94341 WP_000216946.1.9437 WP_000216946.1.94374 WP_000216946.1.94375 WP_000216946.1.94376 WP_000216946.1.94389 WP_000216946.1.94414 WP_000216946.1.94484 WP_000216946.1.94505 WP_000216946.1.94530 WP_000216946.1.94536 WP_000216946.1.9455 WP_000216946.1.94550 WP_000216946.1.94576 WP_000216946.1.9464 WP_000216946.1.94688 WP_000216946.1.947 WP_000216946.1.94733 WP_000216946.1.94741 WP_000216946.1.94789 WP_000216946.1.94797 WP_000216946.1.94825 WP_000216946.1.94844 WP_000216946.1.94845 WP_000216946.1.9485 WP_000216946.1.94857 WP_000216946.1.94866 WP_000216946.1.94969 WP_000216946.1.9497 WP_000216946.1.94980 WP_000216946.1.94989 WP_000216946.1.94999 WP_000216946.1.95008 WP_000216946.1.95023 WP_000216946.1.95029 WP_000216946.1.95033 WP_000216946.1.95038 WP_000216946.1.95075 WP_000216946.1.95077 WP_000216946.1.9510 WP_000216946.1.95156 WP_000216946.1.95193 WP_000216946.1.95263 WP_000216946.1.95281 WP_000216946.1.95294 WP_000216946.1.95318 WP_000216946.1.95327 WP_000216946.1.95342 WP_000216946.1.95361 WP_000216946.1.95372 WP_000216946.1.9538 WP_000216946.1.95386 WP_000216946.1.95494 WP_000216946.1.95512 WP_000216946.1.95519 WP_000216946.1.95537 WP_000216946.1.95550 WP_000216946.1.95560 WP_000216946.1.95571 WP_000216946.1.95581 WP_000216946.1.95603 WP_000216946.1.9563 WP_000216946.1.95639 WP_000216946.1.95681 WP_000216946.1.95683 WP_000216946.1.95699 WP_000216946.1.95704 WP_000216946.1.95713 WP_000216946.1.95714 WP_000216946.1.95737 WP_000216946.1.95760 WP_000216946.1.95780 WP_000216946.1.95804 WP_000216946.1.95806 WP_000216946.1.95832 WP_000216946.1.95877 WP_000216946.1.95885 WP_000216946.1.959 WP_000216946.1.95914 WP_000216946.1.95918 WP_000216946.1.95962 WP_000216946.1.95986 WP_000216946.1.95997 WP_000216946.1.96014 WP_000216946.1.96030 WP_000216946.1.96056 WP_000216946.1.96057 WP_000216946.1.96067 WP_000216946.1.96075 WP_000216946.1.96135 WP_000216946.1.96148 WP_000216946.1.96160 WP_000216946.1.96163 WP_000216946.1.96165 WP_000216946.1.9617 WP_000216946.1.96209 WP_000216946.1.96218 WP_000216946.1.96228 WP_000216946.1.96255 WP_000216946.1.96271 WP_000216946.1.96283 WP_000216946.1.96297 WP_000216946.1.96305 WP_000216946.1.96312 WP_000216946.1.96314 WP_000216946.1.96316 WP_000216946.1.96322 WP_000216946.1.96334 WP_000216946.1.96362 WP_000216946.1.96433 WP_000216946.1.96468 WP_000216946.1.96472 WP_000216946.1.9650 WP_000216946.1.96535 WP_000216946.1.96538 WP_000216946.1.96554 WP_000216946.1.96566 WP_000216946.1.96591 WP_000216946.1.96603 WP_000216946.1.96634 WP_000216946.1.96646 WP_000216946.1.96654 WP_000216946.1.96678 WP_000216946.1.96682 WP_000216946.1.96688 WP_000216946.1.96699 WP_000216946.1.96705 WP_000216946.1.96727 WP_000216946.1.9675 WP_000216946.1.96770 WP_000216946.1.96780 WP_000216946.1.96804 WP_000216946.1.96836 WP_000216946.1.96854 WP_000216946.1.96855 WP_000216946.1.96859 WP_000216946.1.96882 WP_000216946.1.96895 WP_000216946.1.96918 WP_000216946.1.96922 WP_000216946.1.9695 WP_000216946.1.96965 WP_000216946.1.96969 WP_000216946.1.96976 WP_000216946.1.96985 WP_000216946.1.96997 WP_000216946.1.97000 WP_000216946.1.97001 WP_000216946.1.97007 WP_000216946.1.97014 WP_000216946.1.97017 WP_000216946.1.97019 WP_000216946.1.97029 WP_000216946.1.97034 WP_000216946.1.97072 WP_000216946.1.97117 WP_000216946.1.97138 WP_000216946.1.97141 WP_000216946.1.97161 WP_000216946.1.97164 WP_000216946.1.97191 WP_000216946.1.97205 WP_000216946.1.97228 WP_000216946.1.97230 WP_000216946.1.97241 WP_000216946.1.97267 WP_000216946.1.97295 WP_000216946.1.97312 WP_000216946.1.97336 WP_000216946.1.97348 WP_000216946.1.97352 WP_000216946.1.97355 WP_000216946.1.97367 WP_000216946.1.9737 WP_000216946.1.97392 WP_000216946.1.97411 WP_000216946.1.97427 WP_000216946.1.9743 WP_000216946.1.97444 WP_000216946.1.97450 WP_000216946.1.97456 WP_000216946.1.97468 WP_000216946.1.97484 WP_000216946.1.97494 WP_000216946.1.97530 WP_000216946.1.97531 WP_000216946.1.97536 WP_000216946.1.97537 WP_000216946.1.97574 WP_000216946.1.97576 WP_000216946.1.97585 WP_000216946.1.97627 WP_000216946.1.97664 WP_000216946.1.97687 WP_000216946.1.97696 WP_000216946.1.97699 WP_000216946.1.97717 WP_000216946.1.97720 WP_000216946.1.97729 WP_000216946.1.97731 WP_000216946.1.97739 WP_000216946.1.97744 WP_000216946.1.97746 WP_000216946.1.97758 WP_000216946.1.97762 WP_000216946.1.97786 WP_000216946.1.97827 WP_000216946.1.97835 WP_000216946.1.9788 WP_000216946.1.9789 WP_000216946.1.97899 WP_000216946.1.97928 WP_000216946.1.97935 WP_000216946.1.97955 WP_000216946.1.97967 WP_000216946.1.97974 WP_000216946.1.97997 WP_000216946.1.97999 WP_000216946.1.98011 WP_000216946.1.98033 WP_000216946.1.98051 WP_000216946.1.98054 WP_000216946.1.98058 WP_000216946.1.98073 WP_000216946.1.98161 WP_000216946.1.98174 WP_000216946.1.98179 WP_000216946.1.98195 WP_000216946.1.98233 WP_000216946.1.98242 WP_000216946.1.98248 WP_000216946.1.98249 WP_000216946.1.98281 WP_000216946.1.98295 WP_000216946.1.98328 WP_000216946.1.98352 WP_000216946.1.98353 WP_000216946.1.98360 WP_000216946.1.98361 WP_000216946.1.98366 WP_000216946.1.98379 WP_000216946.1.98387 WP_000216946.1.98409 WP_000216946.1.98411 WP_000216946.1.98425 WP_000216946.1.98456 WP_000216946.1.98497 WP_000216946.1.98512 WP_000216946.1.98552 WP_000216946.1.98585 WP_000216946.1.986 WP_000216946.1.98609 WP_000216946.1.98655 WP_000216946.1.98659 WP_000216946.1.98667 WP_000216946.1.98706 WP_000216946.1.9872 WP_000216946.1.98723 WP_000216946.1.98730 WP_000216946.1.98741 WP_000216946.1.98750 WP_000216946.1.98767 WP_000216946.1.98786 WP_000216946.1.98797 WP_000216946.1.98821 WP_000216946.1.98837 WP_000216946.1.98842 WP_000216946.1.98858 WP_000216946.1.98874 WP_000216946.1.98880 WP_000216946.1.98883 WP_000216946.1.98894 WP_000216946.1.98967 WP_000216946.1.98978 WP_000216946.1.98985 WP_000216946.1.99009 WP_000216946.1.99025 WP_000216946.1.9910 WP_000216946.1.9912 WP_000216946.1.99136 WP_000216946.1.99155 WP_000216946.1.99171 WP_000216946.1.99207 WP_000216946.1.99249 WP_000216946.1.99283 WP_000216946.1.99308 WP_000216946.1.99359 WP_000216946.1.99405 WP_000216946.1.99414 WP_000216946.1.99418 WP_000216946.1.99430 WP_000216946.1.99459 WP_000216946.1.99492 WP_000216946.1.99509 WP_000216946.1.99519 WP_000216946.1.99523 WP_000216946.1.99536 WP_000216946.1.99538 WP_000216946.1.99564 WP_000216946.1.99569 WP_000216946.1.9960 WP_000216946.1.99631 WP_000216946.1.99638 WP_000216946.1.9965 WP_000216946.1.99686 WP_000216946.1.99830 WP_000216946.1.99849 WP_000216946.1.99850 WP_000216946.1.99859 WP_000216946.1.99860 WP_000216946.1.9987 WP_000216946.1.99884 WP_000216946.1.99888 WP_000216946.1.99926 WP_000216946.1.99954 WP_000216946.1.99955 WP_000216946.1.99979 WP_000216946.1.99984 WP_000216946.1.99985 WP_000216946.1.99999 YP_499928.1.76163 gi|379014607|ref|YP_005290843.1| gi|148267888|ref|YP_001246831.1| gi|479329320|ref|YP_007868379.1| gi|57651900|ref|YP_186287.1| gi|21283017|ref|NP_646105.1| gi|521211992|ref|YP_008168338.1| gi|387150539|ref|YP_005742103.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]