SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161510282|ref|YP_001575941.1| from Staphylococcus aureus subsp. aureus USA300_TCH1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161510282|ref|YP_001575941.1|
Domain Number 1 Region: 13-243
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.83e-62
Family Alanine racemase-like, N-terminal domain 0.00000516
Further Details:      
 
Domain Number 2 Region: 239-378
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.09e-49
Family Alanine racemase 0.0000514
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161510282|ref|YP_001575941.1|
Sequence length 382
Comment alanine racemase [Staphylococcus aureus subsp. aureus USA300_TCH1516]
Sequence
MSDKYYRSAYMNVDLNAVASNFKVFSTLHPNKTVMAVVKANAYGLGSVKVARHLMENGAT
FFAVATLDEAIELRMHGITAKILVLGVLPAKDIDKAIQHRVALTVPSKQWLKEAIKNISG
EQEKKLWLHIKLDTGMGRLGIKDTKTYQEVIEIIQQYEQLVFEGVFTHFACADEPGDMTT
EQYQRFKDMVNEAIKPEYIHCQNSAGSLLMDCQFCNAIRPGISLYGYYPSEYVQQKVKVH
LKPSVQLIANVVQTKTLQAGESVSYGATYTATDPTTIALLPIGYADGYLRIMQGSFVNVN
GHQCEVIGRVCMDQTIVKVPDQVKAGDSVILIDNHRESPQSVEVVAEKQHTINYEVLCNL
SRRLPRIYHDGDQRFVTNELLK
Download sequence
Identical sequences A0A0D6HAU6 A0A0E1AIU3 A0A1E8WV91 A0A2K1A782 A6QIR5 Q2FF55 Q5HED1 Q9ZAH5
gi|151222187|ref|YP_001333009.1| IDP00688 gi|387143787|ref|YP_005732181.1| gi|87161019|ref|YP_494673.1| gi|384870621|ref|YP_005753335.1| gi|161510282|ref|YP_001575941.1| gi|554644969|ref|YP_008716760.1| gi|88195971|ref|YP_500784.1| gi|479330075|ref|YP_007869134.1| WP_001281145.1.100013 WP_001281145.1.100041 WP_001281145.1.100049 WP_001281145.1.100057 WP_001281145.1.100067 WP_001281145.1.100072 WP_001281145.1.100088 WP_001281145.1.100090 WP_001281145.1.100094 WP_001281145.1.100122 WP_001281145.1.100154 WP_001281145.1.100180 WP_001281145.1.100189 WP_001281145.1.100298 WP_001281145.1.100307 WP_001281145.1.100352 WP_001281145.1.100391 WP_001281145.1.10041 WP_001281145.1.100618 WP_001281145.1.100631 WP_001281145.1.100647 WP_001281145.1.100761 WP_001281145.1.100768 WP_001281145.1.100834 WP_001281145.1.100903 WP_001281145.1.100920 WP_001281145.1.100963 WP_001281145.1.100981 WP_001281145.1.100987 WP_001281145.1.101017 WP_001281145.1.101084 WP_001281145.1.101240 WP_001281145.1.101266 WP_001281145.1.101327 WP_001281145.1.101375 WP_001281145.1.101393 WP_001281145.1.101490 WP_001281145.1.101505 WP_001281145.1.101566 WP_001281145.1.101570 WP_001281145.1.101615 WP_001281145.1.10166 WP_001281145.1.101725 WP_001281145.1.101757 WP_001281145.1.101788 WP_001281145.1.101950 WP_001281145.1.1022 WP_001281145.1.10232 WP_001281145.1.10397 WP_001281145.1.10431 WP_001281145.1.10486 WP_001281145.1.10503 WP_001281145.1.10542 WP_001281145.1.10543 WP_001281145.1.10565 WP_001281145.1.10614 WP_001281145.1.10707 WP_001281145.1.10726 WP_001281145.1.10742 WP_001281145.1.10928 WP_001281145.1.10950 WP_001281145.1.11129 WP_001281145.1.1120 WP_001281145.1.11287 WP_001281145.1.11294 WP_001281145.1.11348 WP_001281145.1.11353 WP_001281145.1.1136 WP_001281145.1.11377 WP_001281145.1.11407 WP_001281145.1.11488 WP_001281145.1.11492 WP_001281145.1.11525 WP_001281145.1.11558 WP_001281145.1.11571 WP_001281145.1.11592 WP_001281145.1.11665 WP_001281145.1.11692 WP_001281145.1.117 WP_001281145.1.11719 WP_001281145.1.11720 WP_001281145.1.11795 WP_001281145.1.11829 WP_001281145.1.11991 WP_001281145.1.12005 WP_001281145.1.1205 WP_001281145.1.12073 WP_001281145.1.12098 WP_001281145.1.12123 WP_001281145.1.12179 WP_001281145.1.12181 WP_001281145.1.12226 WP_001281145.1.12233 WP_001281145.1.12297 WP_001281145.1.12328 WP_001281145.1.12447 WP_001281145.1.12498 WP_001281145.1.12639 WP_001281145.1.12715 WP_001281145.1.12771 WP_001281145.1.12822 WP_001281145.1.12833 WP_001281145.1.12845 WP_001281145.1.12862 WP_001281145.1.12903 WP_001281145.1.12937 WP_001281145.1.13039 WP_001281145.1.13072 WP_001281145.1.13091 WP_001281145.1.13104 WP_001281145.1.13317 WP_001281145.1.13322 WP_001281145.1.13468 WP_001281145.1.1347 WP_001281145.1.13486 WP_001281145.1.13531 WP_001281145.1.1355 WP_001281145.1.13556 WP_001281145.1.13568 WP_001281145.1.13617 WP_001281145.1.13654 WP_001281145.1.13683 WP_001281145.1.13726 WP_001281145.1.13727 WP_001281145.1.1374 WP_001281145.1.13755 WP_001281145.1.13757 WP_001281145.1.13772 WP_001281145.1.13804 WP_001281145.1.13805 WP_001281145.1.13914 WP_001281145.1.13940 WP_001281145.1.13983 WP_001281145.1.14071 WP_001281145.1.14076 WP_001281145.1.14112 WP_001281145.1.14153 WP_001281145.1.14233 WP_001281145.1.1426 WP_001281145.1.14364 WP_001281145.1.14365 WP_001281145.1.14366 WP_001281145.1.14394 WP_001281145.1.14418 WP_001281145.1.14475 WP_001281145.1.147 WP_001281145.1.14744 WP_001281145.1.1477 WP_001281145.1.14790 WP_001281145.1.14809 WP_001281145.1.14868 WP_001281145.1.14869 WP_001281145.1.14888 WP_001281145.1.14902 WP_001281145.1.14987 WP_001281145.1.15000 WP_001281145.1.15091 WP_001281145.1.15228 WP_001281145.1.15255 WP_001281145.1.15263 WP_001281145.1.15278 WP_001281145.1.15329 WP_001281145.1.15399 WP_001281145.1.15409 WP_001281145.1.15438 WP_001281145.1.1545 WP_001281145.1.15489 WP_001281145.1.15505 WP_001281145.1.15524 WP_001281145.1.15572 WP_001281145.1.15687 WP_001281145.1.15706 WP_001281145.1.1579 WP_001281145.1.15818 WP_001281145.1.1583 WP_001281145.1.15838 WP_001281145.1.15883 WP_001281145.1.15892 WP_001281145.1.15897 WP_001281145.1.15898 WP_001281145.1.15928 WP_001281145.1.15957 WP_001281145.1.15972 WP_001281145.1.1600 WP_001281145.1.1606 WP_001281145.1.16112 WP_001281145.1.16213 WP_001281145.1.16237 WP_001281145.1.16362 WP_001281145.1.16554 WP_001281145.1.16569 WP_001281145.1.16603 WP_001281145.1.16617 WP_001281145.1.16628 WP_001281145.1.16672 WP_001281145.1.16679 WP_001281145.1.16688 WP_001281145.1.16703 WP_001281145.1.16757 WP_001281145.1.16768 WP_001281145.1.16770 WP_001281145.1.16776 WP_001281145.1.16892 WP_001281145.1.16946 WP_001281145.1.17038 WP_001281145.1.17104 WP_001281145.1.17137 WP_001281145.1.17169 WP_001281145.1.17210 WP_001281145.1.17231 WP_001281145.1.17234 WP_001281145.1.17249 WP_001281145.1.17256 WP_001281145.1.17320 WP_001281145.1.17450 WP_001281145.1.17485 WP_001281145.1.17520 WP_001281145.1.17581 WP_001281145.1.17650 WP_001281145.1.17657 WP_001281145.1.17666 WP_001281145.1.17676 WP_001281145.1.17770 WP_001281145.1.17834 WP_001281145.1.17845 WP_001281145.1.17859 WP_001281145.1.17876 WP_001281145.1.17929 WP_001281145.1.17951 WP_001281145.1.18016 WP_001281145.1.18035 WP_001281145.1.18074 WP_001281145.1.18105 WP_001281145.1.18197 WP_001281145.1.18283 WP_001281145.1.18290 WP_001281145.1.18320 WP_001281145.1.18437 WP_001281145.1.18451 WP_001281145.1.1851 WP_001281145.1.18516 WP_001281145.1.18529 WP_001281145.1.18538 WP_001281145.1.18562 WP_001281145.1.18611 WP_001281145.1.18627 WP_001281145.1.18658 WP_001281145.1.18668 WP_001281145.1.18809 WP_001281145.1.18830 WP_001281145.1.18836 WP_001281145.1.18879 WP_001281145.1.18918 WP_001281145.1.18938 WP_001281145.1.18987 WP_001281145.1.19009 WP_001281145.1.1901 WP_001281145.1.19027 WP_001281145.1.19149 WP_001281145.1.19179 WP_001281145.1.192 WP_001281145.1.19272 WP_001281145.1.19390 WP_001281145.1.19399 WP_001281145.1.19411 WP_001281145.1.19444 WP_001281145.1.19509 WP_001281145.1.19653 WP_001281145.1.19733 WP_001281145.1.1975 WP_001281145.1.19765 WP_001281145.1.19775 WP_001281145.1.19807 WP_001281145.1.19853 WP_001281145.1.20057 WP_001281145.1.20101 WP_001281145.1.2013 WP_001281145.1.20155 WP_001281145.1.20160 WP_001281145.1.20210 WP_001281145.1.20235 WP_001281145.1.20354 WP_001281145.1.20386 WP_001281145.1.20473 WP_001281145.1.20554 WP_001281145.1.20661 WP_001281145.1.20833 WP_001281145.1.20838 WP_001281145.1.20860 WP_001281145.1.20975 WP_001281145.1.21013 WP_001281145.1.21054 WP_001281145.1.21080 WP_001281145.1.21081 WP_001281145.1.2128 WP_001281145.1.21312 WP_001281145.1.21356 WP_001281145.1.21386 WP_001281145.1.21402 WP_001281145.1.21465 WP_001281145.1.2154 WP_001281145.1.21583 WP_001281145.1.21601 WP_001281145.1.21679 WP_001281145.1.21712 WP_001281145.1.21820 WP_001281145.1.21890 WP_001281145.1.21901 WP_001281145.1.22045 WP_001281145.1.22163 WP_001281145.1.22165 WP_001281145.1.22170 WP_001281145.1.22174 WP_001281145.1.22246 WP_001281145.1.22344 WP_001281145.1.22351 WP_001281145.1.22367 WP_001281145.1.22526 WP_001281145.1.22551 WP_001281145.1.22657 WP_001281145.1.22730 WP_001281145.1.22731 WP_001281145.1.2280 WP_001281145.1.22811 WP_001281145.1.22843 WP_001281145.1.22859 WP_001281145.1.22994 WP_001281145.1.23004 WP_001281145.1.23152 WP_001281145.1.23222 WP_001281145.1.23228 WP_001281145.1.23238 WP_001281145.1.23381 WP_001281145.1.23420 WP_001281145.1.23439 WP_001281145.1.23450 WP_001281145.1.23489 WP_001281145.1.23491 WP_001281145.1.23541 WP_001281145.1.23544 WP_001281145.1.23586 WP_001281145.1.23613 WP_001281145.1.23626 WP_001281145.1.2365 WP_001281145.1.23822 WP_001281145.1.23849 WP_001281145.1.23907 WP_001281145.1.23935 WP_001281145.1.23998 WP_001281145.1.24148 WP_001281145.1.24167 WP_001281145.1.2423 WP_001281145.1.24241 WP_001281145.1.24279 WP_001281145.1.24364 WP_001281145.1.24418 WP_001281145.1.2442 WP_001281145.1.24443 WP_001281145.1.24478 WP_001281145.1.2458 WP_001281145.1.24617 WP_001281145.1.24745 WP_001281145.1.24781 WP_001281145.1.2480 WP_001281145.1.24802 WP_001281145.1.24891 WP_001281145.1.25083 WP_001281145.1.25170 WP_001281145.1.25438 WP_001281145.1.25469 WP_001281145.1.25479 WP_001281145.1.25511 WP_001281145.1.25567 WP_001281145.1.25593 WP_001281145.1.25634 WP_001281145.1.25737 WP_001281145.1.25770 WP_001281145.1.2579 WP_001281145.1.25820 WP_001281145.1.25867 WP_001281145.1.25868 WP_001281145.1.25881 WP_001281145.1.25891 WP_001281145.1.25924 WP_001281145.1.2593 WP_001281145.1.26006 WP_001281145.1.26015 WP_001281145.1.262 WP_001281145.1.26293 WP_001281145.1.26307 WP_001281145.1.26370 WP_001281145.1.26405 WP_001281145.1.26481 WP_001281145.1.2656 WP_001281145.1.2658 WP_001281145.1.2661 WP_001281145.1.26626 WP_001281145.1.2664 WP_001281145.1.26663 WP_001281145.1.26733 WP_001281145.1.26771 WP_001281145.1.26790 WP_001281145.1.26927 WP_001281145.1.26958 WP_001281145.1.27042 WP_001281145.1.27154 WP_001281145.1.27246 WP_001281145.1.27311 WP_001281145.1.27333 WP_001281145.1.2734 WP_001281145.1.27345 WP_001281145.1.27455 WP_001281145.1.27457 WP_001281145.1.27551 WP_001281145.1.27562 WP_001281145.1.2759 WP_001281145.1.27608 WP_001281145.1.27614 WP_001281145.1.27615 WP_001281145.1.27621 WP_001281145.1.27654 WP_001281145.1.27670 WP_001281145.1.2768 WP_001281145.1.27717 WP_001281145.1.27748 WP_001281145.1.27817 WP_001281145.1.27854 WP_001281145.1.27950 WP_001281145.1.27953 WP_001281145.1.27972 WP_001281145.1.28007 WP_001281145.1.28025 WP_001281145.1.28063 WP_001281145.1.28071 WP_001281145.1.28088 WP_001281145.1.28117 WP_001281145.1.28138 WP_001281145.1.28147 WP_001281145.1.28158 WP_001281145.1.28191 WP_001281145.1.28207 WP_001281145.1.28358 WP_001281145.1.28360 WP_001281145.1.28376 WP_001281145.1.28381 WP_001281145.1.28477 WP_001281145.1.28498 WP_001281145.1.28502 WP_001281145.1.28527 WP_001281145.1.28532 WP_001281145.1.28629 WP_001281145.1.28650 WP_001281145.1.28675 WP_001281145.1.28710 WP_001281145.1.28725 WP_001281145.1.28862 WP_001281145.1.28887 WP_001281145.1.28933 WP_001281145.1.28960 WP_001281145.1.28970 WP_001281145.1.29090 WP_001281145.1.29107 WP_001281145.1.29188 WP_001281145.1.29207 WP_001281145.1.29272 WP_001281145.1.29282 WP_001281145.1.29285 WP_001281145.1.29312 WP_001281145.1.29372 WP_001281145.1.29373 WP_001281145.1.29381 WP_001281145.1.29511 WP_001281145.1.29541 WP_001281145.1.29561 WP_001281145.1.29596 WP_001281145.1.29644 WP_001281145.1.29676 WP_001281145.1.2975 WP_001281145.1.29758 WP_001281145.1.29781 WP_001281145.1.29805 WP_001281145.1.29885 WP_001281145.1.29963 WP_001281145.1.30012 WP_001281145.1.30023 WP_001281145.1.30033 WP_001281145.1.30047 WP_001281145.1.30057 WP_001281145.1.30154 WP_001281145.1.30176 WP_001281145.1.30186 WP_001281145.1.30274 WP_001281145.1.30333 WP_001281145.1.30367 WP_001281145.1.30376 WP_001281145.1.30381 WP_001281145.1.30418 WP_001281145.1.30422 WP_001281145.1.30477 WP_001281145.1.30530 WP_001281145.1.30623 WP_001281145.1.30758 WP_001281145.1.30779 WP_001281145.1.30846 WP_001281145.1.30862 WP_001281145.1.30863 WP_001281145.1.30874 WP_001281145.1.30878 WP_001281145.1.30889 WP_001281145.1.30916 WP_001281145.1.3097 WP_001281145.1.30970 WP_001281145.1.30971 WP_001281145.1.30998 WP_001281145.1.31037 WP_001281145.1.31068 WP_001281145.1.31124 WP_001281145.1.31194 WP_001281145.1.31232 WP_001281145.1.31376 WP_001281145.1.31436 WP_001281145.1.31462 WP_001281145.1.31478 WP_001281145.1.315 WP_001281145.1.31567 WP_001281145.1.31611 WP_001281145.1.31638 WP_001281145.1.31667 WP_001281145.1.31787 WP_001281145.1.31797 WP_001281145.1.31817 WP_001281145.1.31897 WP_001281145.1.31925 WP_001281145.1.31949 WP_001281145.1.31990 WP_001281145.1.31994 WP_001281145.1.32040 WP_001281145.1.32059 WP_001281145.1.32118 WP_001281145.1.32122 WP_001281145.1.32125 WP_001281145.1.32167 WP_001281145.1.32217 WP_001281145.1.32244 WP_001281145.1.32248 WP_001281145.1.32281 WP_001281145.1.32295 WP_001281145.1.32365 WP_001281145.1.32384 WP_001281145.1.32405 WP_001281145.1.3244 WP_001281145.1.32454 WP_001281145.1.32464 WP_001281145.1.32739 WP_001281145.1.32839 WP_001281145.1.32921 WP_001281145.1.32987 WP_001281145.1.3299 WP_001281145.1.3306 WP_001281145.1.33108 WP_001281145.1.33147 WP_001281145.1.33213 WP_001281145.1.33252 WP_001281145.1.33255 WP_001281145.1.33292 WP_001281145.1.33307 WP_001281145.1.3335 WP_001281145.1.33350 WP_001281145.1.33372 WP_001281145.1.3338 WP_001281145.1.33388 WP_001281145.1.33394 WP_001281145.1.33426 WP_001281145.1.3345 WP_001281145.1.33463 WP_001281145.1.33483 WP_001281145.1.33484 WP_001281145.1.33520 WP_001281145.1.33575 WP_001281145.1.33640 WP_001281145.1.33650 WP_001281145.1.33724 WP_001281145.1.33737 WP_001281145.1.33756 WP_001281145.1.33766 WP_001281145.1.33778 WP_001281145.1.33899 WP_001281145.1.33949 WP_001281145.1.33994 WP_001281145.1.34069 WP_001281145.1.34105 WP_001281145.1.34112 WP_001281145.1.34168 WP_001281145.1.3418 WP_001281145.1.34194 WP_001281145.1.34361 WP_001281145.1.3442 WP_001281145.1.34471 WP_001281145.1.3448 WP_001281145.1.34512 WP_001281145.1.34531 WP_001281145.1.34716 WP_001281145.1.34723 WP_001281145.1.3474 WP_001281145.1.34741 WP_001281145.1.34847 WP_001281145.1.34865 WP_001281145.1.34923 WP_001281145.1.34926 WP_001281145.1.34967 WP_001281145.1.35014 WP_001281145.1.35031 WP_001281145.1.35032 WP_001281145.1.35289 WP_001281145.1.35307 WP_001281145.1.35314 WP_001281145.1.35340 WP_001281145.1.35391 WP_001281145.1.35413 WP_001281145.1.35508 WP_001281145.1.35517 WP_001281145.1.35519 WP_001281145.1.35549 WP_001281145.1.35642 WP_001281145.1.35661 WP_001281145.1.35686 WP_001281145.1.35696 WP_001281145.1.35784 WP_001281145.1.3579 WP_001281145.1.35837 WP_001281145.1.35890 WP_001281145.1.35903 WP_001281145.1.36093 WP_001281145.1.36179 WP_001281145.1.36208 WP_001281145.1.36249 WP_001281145.1.36302 WP_001281145.1.36430 WP_001281145.1.36434 WP_001281145.1.36439 WP_001281145.1.36640 WP_001281145.1.36704 WP_001281145.1.36773 WP_001281145.1.36814 WP_001281145.1.36847 WP_001281145.1.36888 WP_001281145.1.36903 WP_001281145.1.36911 WP_001281145.1.36983 WP_001281145.1.3709 WP_001281145.1.37120 WP_001281145.1.37130 WP_001281145.1.37145 WP_001281145.1.37159 WP_001281145.1.3722 WP_001281145.1.37240 WP_001281145.1.37335 WP_001281145.1.37378 WP_001281145.1.37411 WP_001281145.1.37435 WP_001281145.1.37546 WP_001281145.1.37644 WP_001281145.1.37669 WP_001281145.1.37679 WP_001281145.1.3774 WP_001281145.1.37749 WP_001281145.1.37764 WP_001281145.1.37771 WP_001281145.1.37788 WP_001281145.1.37851 WP_001281145.1.37906 WP_001281145.1.37907 WP_001281145.1.37929 WP_001281145.1.38030 WP_001281145.1.38100 WP_001281145.1.38111 WP_001281145.1.38128 WP_001281145.1.38136 WP_001281145.1.38222 WP_001281145.1.38304 WP_001281145.1.38435 WP_001281145.1.38516 WP_001281145.1.38555 WP_001281145.1.38688 WP_001281145.1.3875 WP_001281145.1.38875 WP_001281145.1.38885 WP_001281145.1.38890 WP_001281145.1.38927 WP_001281145.1.39017 WP_001281145.1.39026 WP_001281145.1.39126 WP_001281145.1.39166 WP_001281145.1.39324 WP_001281145.1.39330 WP_001281145.1.39361 WP_001281145.1.39432 WP_001281145.1.39499 WP_001281145.1.39542 WP_001281145.1.39642 WP_001281145.1.39670 WP_001281145.1.39671 WP_001281145.1.39682 WP_001281145.1.39693 WP_001281145.1.39857 WP_001281145.1.39943 WP_001281145.1.39995 WP_001281145.1.40076 WP_001281145.1.4010 WP_001281145.1.40149 WP_001281145.1.40247 WP_001281145.1.40329 WP_001281145.1.40369 WP_001281145.1.40428 WP_001281145.1.40483 WP_001281145.1.40500 WP_001281145.1.40613 WP_001281145.1.40670 WP_001281145.1.40700 WP_001281145.1.40719 WP_001281145.1.40729 WP_001281145.1.40780 WP_001281145.1.40814 WP_001281145.1.40939 WP_001281145.1.40997 WP_001281145.1.41033 WP_001281145.1.41038 WP_001281145.1.4105 WP_001281145.1.41350 WP_001281145.1.41374 WP_001281145.1.41386 WP_001281145.1.41389 WP_001281145.1.41555 WP_001281145.1.41581 WP_001281145.1.41587 WP_001281145.1.41598 WP_001281145.1.41612 WP_001281145.1.41620 WP_001281145.1.41681 WP_001281145.1.4169 WP_001281145.1.41743 WP_001281145.1.41755 WP_001281145.1.41796 WP_001281145.1.4182 WP_001281145.1.41863 WP_001281145.1.41972 WP_001281145.1.42003 WP_001281145.1.4202 WP_001281145.1.42056 WP_001281145.1.42072 WP_001281145.1.42085 WP_001281145.1.42169 WP_001281145.1.42178 WP_001281145.1.42241 WP_001281145.1.4225 WP_001281145.1.42286 WP_001281145.1.42298 WP_001281145.1.42325 WP_001281145.1.42344 WP_001281145.1.42607 WP_001281145.1.42681 WP_001281145.1.42733 WP_001281145.1.42764 WP_001281145.1.42788 WP_001281145.1.42798 WP_001281145.1.42816 WP_001281145.1.42907 WP_001281145.1.42925 WP_001281145.1.42959 WP_001281145.1.42984 WP_001281145.1.42990 WP_001281145.1.43023 WP_001281145.1.43061 WP_001281145.1.43095 WP_001281145.1.43110 WP_001281145.1.43125 WP_001281145.1.43139 WP_001281145.1.43168 WP_001281145.1.43179 WP_001281145.1.43204 WP_001281145.1.43252 WP_001281145.1.43279 WP_001281145.1.43360 WP_001281145.1.43375 WP_001281145.1.43405 WP_001281145.1.43446 WP_001281145.1.43512 WP_001281145.1.43665 WP_001281145.1.43784 WP_001281145.1.4386 WP_001281145.1.43964 WP_001281145.1.43995 WP_001281145.1.44074 WP_001281145.1.44177 WP_001281145.1.44178 WP_001281145.1.44344 WP_001281145.1.44382 WP_001281145.1.44432 WP_001281145.1.44504 WP_001281145.1.44515 WP_001281145.1.44520 WP_001281145.1.44586 WP_001281145.1.44623 WP_001281145.1.44655 WP_001281145.1.44667 WP_001281145.1.447 WP_001281145.1.44714 WP_001281145.1.44715 WP_001281145.1.44856 WP_001281145.1.44868 WP_001281145.1.44876 WP_001281145.1.44892 WP_001281145.1.44940 WP_001281145.1.44993 WP_001281145.1.45042 WP_001281145.1.45080 WP_001281145.1.45091 WP_001281145.1.45094 WP_001281145.1.45140 WP_001281145.1.45157 WP_001281145.1.45162 WP_001281145.1.45223 WP_001281145.1.45242 WP_001281145.1.45267 WP_001281145.1.4527 WP_001281145.1.45281 WP_001281145.1.4545 WP_001281145.1.45450 WP_001281145.1.45456 WP_001281145.1.4546 WP_001281145.1.45542 WP_001281145.1.45555 WP_001281145.1.45574 WP_001281145.1.45610 WP_001281145.1.45645 WP_001281145.1.45705 WP_001281145.1.45763 WP_001281145.1.4577 WP_001281145.1.45773 WP_001281145.1.4582 WP_001281145.1.45859 WP_001281145.1.45862 WP_001281145.1.45874 WP_001281145.1.4597 WP_001281145.1.45972 WP_001281145.1.45977 WP_001281145.1.45979 WP_001281145.1.46035 WP_001281145.1.46037 WP_001281145.1.46050 WP_001281145.1.46062 WP_001281145.1.46078 WP_001281145.1.46171 WP_001281145.1.46172 WP_001281145.1.46185 WP_001281145.1.46248 WP_001281145.1.46333 WP_001281145.1.46339 WP_001281145.1.46353 WP_001281145.1.46529 WP_001281145.1.46619 WP_001281145.1.46648 WP_001281145.1.46676 WP_001281145.1.46720 WP_001281145.1.46736 WP_001281145.1.46770 WP_001281145.1.4680 WP_001281145.1.46906 WP_001281145.1.46914 WP_001281145.1.46929 WP_001281145.1.4694 WP_001281145.1.46947 WP_001281145.1.47002 WP_001281145.1.47090 WP_001281145.1.47107 WP_001281145.1.47111 WP_001281145.1.47282 WP_001281145.1.47331 WP_001281145.1.47334 WP_001281145.1.47450 WP_001281145.1.47459 WP_001281145.1.47522 WP_001281145.1.47617 WP_001281145.1.47669 WP_001281145.1.47680 WP_001281145.1.47747 WP_001281145.1.47851 WP_001281145.1.47908 WP_001281145.1.4792 WP_001281145.1.48046 WP_001281145.1.48057 WP_001281145.1.48064 WP_001281145.1.48067 WP_001281145.1.48116 WP_001281145.1.48142 WP_001281145.1.48156 WP_001281145.1.48187 WP_001281145.1.48223 WP_001281145.1.48272 WP_001281145.1.48282 WP_001281145.1.48310 WP_001281145.1.48335 WP_001281145.1.48338 WP_001281145.1.48376 WP_001281145.1.48398 WP_001281145.1.4840 WP_001281145.1.48427 WP_001281145.1.48437 WP_001281145.1.48438 WP_001281145.1.48479 WP_001281145.1.4852 WP_001281145.1.48580 WP_001281145.1.48664 WP_001281145.1.48670 WP_001281145.1.48723 WP_001281145.1.48769 WP_001281145.1.48782 WP_001281145.1.48869 WP_001281145.1.49018 WP_001281145.1.49071 WP_001281145.1.49094 WP_001281145.1.49105 WP_001281145.1.49171 WP_001281145.1.49189 WP_001281145.1.49196 WP_001281145.1.49199 WP_001281145.1.4924 WP_001281145.1.49257 WP_001281145.1.49301 WP_001281145.1.49326 WP_001281145.1.49362 WP_001281145.1.49418 WP_001281145.1.4945 WP_001281145.1.49518 WP_001281145.1.49549 WP_001281145.1.49581 WP_001281145.1.49582 WP_001281145.1.496 WP_001281145.1.49603 WP_001281145.1.49643 WP_001281145.1.49672 WP_001281145.1.49690 WP_001281145.1.49728 WP_001281145.1.49732 WP_001281145.1.49745 WP_001281145.1.49819 WP_001281145.1.49918 WP_001281145.1.49935 WP_001281145.1.50028 WP_001281145.1.50117 WP_001281145.1.50145 WP_001281145.1.50178 WP_001281145.1.50192 WP_001281145.1.50291 WP_001281145.1.50367 WP_001281145.1.50388 WP_001281145.1.5045 WP_001281145.1.50464 WP_001281145.1.50525 WP_001281145.1.50558 WP_001281145.1.50568 WP_001281145.1.5059 WP_001281145.1.50594 WP_001281145.1.50647 WP_001281145.1.50699 WP_001281145.1.50740 WP_001281145.1.50817 WP_001281145.1.50829 WP_001281145.1.50974 WP_001281145.1.51015 WP_001281145.1.51130 WP_001281145.1.51209 WP_001281145.1.51226 WP_001281145.1.51271 WP_001281145.1.51277 WP_001281145.1.51326 WP_001281145.1.51365 WP_001281145.1.51393 WP_001281145.1.51496 WP_001281145.1.51557 WP_001281145.1.51741 WP_001281145.1.51794 WP_001281145.1.51824 WP_001281145.1.52034 WP_001281145.1.52061 WP_001281145.1.52072 WP_001281145.1.52195 WP_001281145.1.52198 WP_001281145.1.52210 WP_001281145.1.52289 WP_001281145.1.52308 WP_001281145.1.52343 WP_001281145.1.52377 WP_001281145.1.52396 WP_001281145.1.52427 WP_001281145.1.52452 WP_001281145.1.5251 WP_001281145.1.52511 WP_001281145.1.52605 WP_001281145.1.52830 WP_001281145.1.52889 WP_001281145.1.52900 WP_001281145.1.52965 WP_001281145.1.52983 WP_001281145.1.5304 WP_001281145.1.53050 WP_001281145.1.53057 WP_001281145.1.5319 WP_001281145.1.53245 WP_001281145.1.53312 WP_001281145.1.53363 WP_001281145.1.53373 WP_001281145.1.53379 WP_001281145.1.53408 WP_001281145.1.53452 WP_001281145.1.53467 WP_001281145.1.53532 WP_001281145.1.53774 WP_001281145.1.53799 WP_001281145.1.53911 WP_001281145.1.53926 WP_001281145.1.54049 WP_001281145.1.54074 WP_001281145.1.54086 WP_001281145.1.54237 WP_001281145.1.54290 WP_001281145.1.54404 WP_001281145.1.54438 WP_001281145.1.54471 WP_001281145.1.54479 WP_001281145.1.54485 WP_001281145.1.54554 WP_001281145.1.54574 WP_001281145.1.54744 WP_001281145.1.54830 WP_001281145.1.54851 WP_001281145.1.54929 WP_001281145.1.54931 WP_001281145.1.54967 WP_001281145.1.54990 WP_001281145.1.5500 WP_001281145.1.55004 WP_001281145.1.55082 WP_001281145.1.55084 WP_001281145.1.55095 WP_001281145.1.55139 WP_001281145.1.5518 WP_001281145.1.552 WP_001281145.1.55239 WP_001281145.1.55271 WP_001281145.1.55327 WP_001281145.1.55336 WP_001281145.1.55419 WP_001281145.1.55495 WP_001281145.1.5550 WP_001281145.1.55527 WP_001281145.1.55535 WP_001281145.1.55603 WP_001281145.1.55719 WP_001281145.1.55724 WP_001281145.1.55845 WP_001281145.1.55949 WP_001281145.1.55955 WP_001281145.1.56003 WP_001281145.1.5604 WP_001281145.1.56064 WP_001281145.1.56106 WP_001281145.1.56135 WP_001281145.1.56159 WP_001281145.1.56200 WP_001281145.1.56220 WP_001281145.1.56237 WP_001281145.1.56265 WP_001281145.1.56377 WP_001281145.1.56387 WP_001281145.1.56464 WP_001281145.1.56482 WP_001281145.1.56527 WP_001281145.1.56542 WP_001281145.1.56608 WP_001281145.1.56619 WP_001281145.1.56702 WP_001281145.1.56708 WP_001281145.1.56737 WP_001281145.1.5675 WP_001281145.1.56779 WP_001281145.1.56822 WP_001281145.1.56903 WP_001281145.1.56931 WP_001281145.1.56966 WP_001281145.1.56975 WP_001281145.1.57015 WP_001281145.1.5705 WP_001281145.1.57081 WP_001281145.1.57115 WP_001281145.1.57141 WP_001281145.1.57330 WP_001281145.1.57427 WP_001281145.1.57448 WP_001281145.1.5749 WP_001281145.1.57593 WP_001281145.1.57670 WP_001281145.1.57693 WP_001281145.1.57701 WP_001281145.1.57718 WP_001281145.1.57727 WP_001281145.1.57745 WP_001281145.1.57783 WP_001281145.1.57844 WP_001281145.1.57962 WP_001281145.1.5799 WP_001281145.1.58006 WP_001281145.1.58051 WP_001281145.1.58122 WP_001281145.1.5817 WP_001281145.1.58185 WP_001281145.1.58198 WP_001281145.1.58241 WP_001281145.1.58246 WP_001281145.1.58325 WP_001281145.1.58350 WP_001281145.1.58353 WP_001281145.1.58366 WP_001281145.1.58373 WP_001281145.1.58392 WP_001281145.1.58421 WP_001281145.1.58481 WP_001281145.1.5849 WP_001281145.1.58495 WP_001281145.1.58508 WP_001281145.1.58521 WP_001281145.1.586 WP_001281145.1.58603 WP_001281145.1.58714 WP_001281145.1.58775 WP_001281145.1.58936 WP_001281145.1.58960 WP_001281145.1.58998 WP_001281145.1.5901 WP_001281145.1.5904 WP_001281145.1.59133 WP_001281145.1.5925 WP_001281145.1.59269 WP_001281145.1.59284 WP_001281145.1.59327 WP_001281145.1.59363 WP_001281145.1.59397 WP_001281145.1.59457 WP_001281145.1.59459 WP_001281145.1.59467 WP_001281145.1.59478 WP_001281145.1.59603 WP_001281145.1.59609 WP_001281145.1.59629 WP_001281145.1.59663 WP_001281145.1.59697 WP_001281145.1.59803 WP_001281145.1.59881 WP_001281145.1.59886 WP_001281145.1.59977 WP_001281145.1.60022 WP_001281145.1.60086 WP_001281145.1.60156 WP_001281145.1.60181 WP_001281145.1.60251 WP_001281145.1.60259 WP_001281145.1.60280 WP_001281145.1.60307 WP_001281145.1.60368 WP_001281145.1.60462 WP_001281145.1.60515 WP_001281145.1.60551 WP_001281145.1.60594 WP_001281145.1.60690 WP_001281145.1.60696 WP_001281145.1.60787 WP_001281145.1.60898 WP_001281145.1.60939 WP_001281145.1.60981 WP_001281145.1.61030 WP_001281145.1.61119 WP_001281145.1.61152 WP_001281145.1.61153 WP_001281145.1.6118 WP_001281145.1.61188 WP_001281145.1.61257 WP_001281145.1.61324 WP_001281145.1.61339 WP_001281145.1.61408 WP_001281145.1.61413 WP_001281145.1.61421 WP_001281145.1.61547 WP_001281145.1.61591 WP_001281145.1.6168 WP_001281145.1.61784 WP_001281145.1.61910 WP_001281145.1.61970 WP_001281145.1.62030 WP_001281145.1.62088 WP_001281145.1.62093 WP_001281145.1.62140 WP_001281145.1.62164 WP_001281145.1.62367 WP_001281145.1.62409 WP_001281145.1.62437 WP_001281145.1.62459 WP_001281145.1.62537 WP_001281145.1.62539 WP_001281145.1.62575 WP_001281145.1.62685 WP_001281145.1.62740 WP_001281145.1.62756 WP_001281145.1.62781 WP_001281145.1.62796 WP_001281145.1.62808 WP_001281145.1.62829 WP_001281145.1.62842 WP_001281145.1.62878 WP_001281145.1.62956 WP_001281145.1.63011 WP_001281145.1.63050 WP_001281145.1.631 WP_001281145.1.63132 WP_001281145.1.63182 WP_001281145.1.63195 WP_001281145.1.63233 WP_001281145.1.63244 WP_001281145.1.63273 WP_001281145.1.63279 WP_001281145.1.63296 WP_001281145.1.63307 WP_001281145.1.63319 WP_001281145.1.63324 WP_001281145.1.63335 WP_001281145.1.63337 WP_001281145.1.63383 WP_001281145.1.63406 WP_001281145.1.63411 WP_001281145.1.63421 WP_001281145.1.63460 WP_001281145.1.63510 WP_001281145.1.63527 WP_001281145.1.63565 WP_001281145.1.63617 WP_001281145.1.63693 WP_001281145.1.63705 WP_001281145.1.6378 WP_001281145.1.63847 WP_001281145.1.63894 WP_001281145.1.63947 WP_001281145.1.64012 WP_001281145.1.64094 WP_001281145.1.64108 WP_001281145.1.64207 WP_001281145.1.64251 WP_001281145.1.64303 WP_001281145.1.64368 WP_001281145.1.64400 WP_001281145.1.64598 WP_001281145.1.64628 WP_001281145.1.64643 WP_001281145.1.64665 WP_001281145.1.64811 WP_001281145.1.64845 WP_001281145.1.64860 WP_001281145.1.64951 WP_001281145.1.64956 WP_001281145.1.64996 WP_001281145.1.64998 WP_001281145.1.65025 WP_001281145.1.65038 WP_001281145.1.65076 WP_001281145.1.65233 WP_001281145.1.65264 WP_001281145.1.65358 WP_001281145.1.65387 WP_001281145.1.65406 WP_001281145.1.65407 WP_001281145.1.6544 WP_001281145.1.65448 WP_001281145.1.65585 WP_001281145.1.65616 WP_001281145.1.65629 WP_001281145.1.65643 WP_001281145.1.65656 WP_001281145.1.6568 WP_001281145.1.65713 WP_001281145.1.65734 WP_001281145.1.65769 WP_001281145.1.65809 WP_001281145.1.6585 WP_001281145.1.65892 WP_001281145.1.65935 WP_001281145.1.65947 WP_001281145.1.65965 WP_001281145.1.6603 WP_001281145.1.66054 WP_001281145.1.66069 WP_001281145.1.66073 WP_001281145.1.66130 WP_001281145.1.66144 WP_001281145.1.66265 WP_001281145.1.66298 WP_001281145.1.6632 WP_001281145.1.66366 WP_001281145.1.66453 WP_001281145.1.66513 WP_001281145.1.66556 WP_001281145.1.66598 WP_001281145.1.66611 WP_001281145.1.66614 WP_001281145.1.66705 WP_001281145.1.66756 WP_001281145.1.66766 WP_001281145.1.66803 WP_001281145.1.66816 WP_001281145.1.6688 WP_001281145.1.66938 WP_001281145.1.66969 WP_001281145.1.67012 WP_001281145.1.67014 WP_001281145.1.67067 WP_001281145.1.67072 WP_001281145.1.67113 WP_001281145.1.67155 WP_001281145.1.67160 WP_001281145.1.67238 WP_001281145.1.67251 WP_001281145.1.67259 WP_001281145.1.6726 WP_001281145.1.67286 WP_001281145.1.67294 WP_001281145.1.67312 WP_001281145.1.67328 WP_001281145.1.67418 WP_001281145.1.67420 WP_001281145.1.67425 WP_001281145.1.67457 WP_001281145.1.67460 WP_001281145.1.67540 WP_001281145.1.67571 WP_001281145.1.67621 WP_001281145.1.67644 WP_001281145.1.67653 WP_001281145.1.67691 WP_001281145.1.67806 WP_001281145.1.67834 WP_001281145.1.67867 WP_001281145.1.67880 WP_001281145.1.67900 WP_001281145.1.67991 WP_001281145.1.68101 WP_001281145.1.68134 WP_001281145.1.68141 WP_001281145.1.68152 WP_001281145.1.68202 WP_001281145.1.68221 WP_001281145.1.68223 WP_001281145.1.6824 WP_001281145.1.68268 WP_001281145.1.68286 WP_001281145.1.68299 WP_001281145.1.68355 WP_001281145.1.68366 WP_001281145.1.68398 WP_001281145.1.68399 WP_001281145.1.68476 WP_001281145.1.68479 WP_001281145.1.68504 WP_001281145.1.68548 WP_001281145.1.686 WP_001281145.1.68681 WP_001281145.1.68683 WP_001281145.1.68741 WP_001281145.1.68743 WP_001281145.1.68883 WP_001281145.1.68998 WP_001281145.1.69012 WP_001281145.1.69071 WP_001281145.1.69078 WP_001281145.1.69105 WP_001281145.1.6915 WP_001281145.1.69198 WP_001281145.1.69213 WP_001281145.1.69349 WP_001281145.1.69394 WP_001281145.1.69437 WP_001281145.1.69475 WP_001281145.1.69490 WP_001281145.1.69546 WP_001281145.1.69598 WP_001281145.1.6968 WP_001281145.1.69683 WP_001281145.1.69724 WP_001281145.1.69734 WP_001281145.1.6980 WP_001281145.1.69820 WP_001281145.1.69823 WP_001281145.1.69830 WP_001281145.1.69882 WP_001281145.1.699 WP_001281145.1.69902 WP_001281145.1.69934 WP_001281145.1.69980 WP_001281145.1.69995 WP_001281145.1.70059 WP_001281145.1.70161 WP_001281145.1.70220 WP_001281145.1.70225 WP_001281145.1.70228 WP_001281145.1.70294 WP_001281145.1.70311 WP_001281145.1.70313 WP_001281145.1.70334 WP_001281145.1.70448 WP_001281145.1.7046 WP_001281145.1.70487 WP_001281145.1.70495 WP_001281145.1.70527 WP_001281145.1.70554 WP_001281145.1.70558 WP_001281145.1.70564 WP_001281145.1.7064 WP_001281145.1.70664 WP_001281145.1.707 WP_001281145.1.70721 WP_001281145.1.70763 WP_001281145.1.70808 WP_001281145.1.70829 WP_001281145.1.70835 WP_001281145.1.70843 WP_001281145.1.70909 WP_001281145.1.70926 WP_001281145.1.710 WP_001281145.1.71016 WP_001281145.1.7105 WP_001281145.1.71208 WP_001281145.1.71231 WP_001281145.1.71267 WP_001281145.1.71313 WP_001281145.1.71410 WP_001281145.1.71467 WP_001281145.1.71475 WP_001281145.1.71721 WP_001281145.1.71737 WP_001281145.1.71739 WP_001281145.1.71741 WP_001281145.1.71863 WP_001281145.1.71877 WP_001281145.1.71892 WP_001281145.1.71899 WP_001281145.1.71910 WP_001281145.1.71978 WP_001281145.1.72002 WP_001281145.1.72018 WP_001281145.1.72085 WP_001281145.1.72148 WP_001281145.1.72204 WP_001281145.1.72306 WP_001281145.1.72340 WP_001281145.1.72363 WP_001281145.1.72371 WP_001281145.1.72453 WP_001281145.1.72465 WP_001281145.1.72497 WP_001281145.1.7254 WP_001281145.1.7258 WP_001281145.1.7260 WP_001281145.1.72649 WP_001281145.1.72666 WP_001281145.1.72708 WP_001281145.1.72719 WP_001281145.1.72753 WP_001281145.1.72762 WP_001281145.1.72881 WP_001281145.1.72961 WP_001281145.1.72991 WP_001281145.1.73002 WP_001281145.1.73021 WP_001281145.1.73087 WP_001281145.1.73140 WP_001281145.1.73190 WP_001281145.1.73195 WP_001281145.1.73201 WP_001281145.1.73211 WP_001281145.1.73240 WP_001281145.1.73241 WP_001281145.1.73264 WP_001281145.1.73401 WP_001281145.1.73420 WP_001281145.1.73450 WP_001281145.1.73464 WP_001281145.1.73513 WP_001281145.1.73539 WP_001281145.1.7360 WP_001281145.1.73610 WP_001281145.1.7365 WP_001281145.1.73674 WP_001281145.1.73694 WP_001281145.1.73740 WP_001281145.1.73789 WP_001281145.1.73885 WP_001281145.1.73900 WP_001281145.1.73921 WP_001281145.1.73940 WP_001281145.1.73949 WP_001281145.1.73971 WP_001281145.1.74004 WP_001281145.1.7401 WP_001281145.1.7406 WP_001281145.1.74073 WP_001281145.1.74085 WP_001281145.1.74155 WP_001281145.1.74257 WP_001281145.1.74284 WP_001281145.1.74295 WP_001281145.1.74327 WP_001281145.1.74456 WP_001281145.1.74468 WP_001281145.1.74576 WP_001281145.1.74676 WP_001281145.1.74681 WP_001281145.1.74758 WP_001281145.1.74770 WP_001281145.1.74785 WP_001281145.1.74797 WP_001281145.1.7482 WP_001281145.1.74874 WP_001281145.1.75070 WP_001281145.1.75111 WP_001281145.1.75131 WP_001281145.1.75132 WP_001281145.1.75323 WP_001281145.1.75351 WP_001281145.1.75356 WP_001281145.1.75409 WP_001281145.1.75538 WP_001281145.1.75566 WP_001281145.1.75571 WP_001281145.1.75647 WP_001281145.1.75692 WP_001281145.1.75728 WP_001281145.1.75743 WP_001281145.1.75800 WP_001281145.1.75809 WP_001281145.1.75840 WP_001281145.1.75862 WP_001281145.1.75910 WP_001281145.1.76013 WP_001281145.1.7602 WP_001281145.1.76047 WP_001281145.1.76049 WP_001281145.1.76050 WP_001281145.1.76053 WP_001281145.1.76111 WP_001281145.1.76114 WP_001281145.1.76121 WP_001281145.1.76153 WP_001281145.1.76179 WP_001281145.1.7627 WP_001281145.1.76313 WP_001281145.1.76424 WP_001281145.1.76426 WP_001281145.1.76431 WP_001281145.1.76463 WP_001281145.1.76497 WP_001281145.1.76674 WP_001281145.1.76711 WP_001281145.1.76718 WP_001281145.1.76798 WP_001281145.1.76803 WP_001281145.1.76829 WP_001281145.1.7694 WP_001281145.1.77043 WP_001281145.1.77072 WP_001281145.1.77137 WP_001281145.1.77158 WP_001281145.1.77190 WP_001281145.1.77203 WP_001281145.1.77229 WP_001281145.1.77297 WP_001281145.1.77298 WP_001281145.1.77331 WP_001281145.1.77346 WP_001281145.1.77359 WP_001281145.1.77388 WP_001281145.1.77426 WP_001281145.1.77498 WP_001281145.1.77532 WP_001281145.1.77650 WP_001281145.1.77735 WP_001281145.1.77791 WP_001281145.1.7785 WP_001281145.1.7786 WP_001281145.1.77882 WP_001281145.1.77893 WP_001281145.1.77915 WP_001281145.1.77922 WP_001281145.1.77930 WP_001281145.1.77986 WP_001281145.1.78038 WP_001281145.1.78082 WP_001281145.1.78093 WP_001281145.1.78164 WP_001281145.1.78179 WP_001281145.1.78194 WP_001281145.1.78304 WP_001281145.1.7833 WP_001281145.1.78330 WP_001281145.1.78335 WP_001281145.1.78371 WP_001281145.1.78392 WP_001281145.1.78434 WP_001281145.1.78436 WP_001281145.1.78470 WP_001281145.1.78489 WP_001281145.1.78494 WP_001281145.1.7853 WP_001281145.1.78573 WP_001281145.1.78585 WP_001281145.1.78592 WP_001281145.1.78662 WP_001281145.1.7868 WP_001281145.1.78685 WP_001281145.1.78736 WP_001281145.1.78758 WP_001281145.1.78763 WP_001281145.1.78816 WP_001281145.1.78920 WP_001281145.1.78937 WP_001281145.1.78991 WP_001281145.1.78995 WP_001281145.1.7905 WP_001281145.1.79110 WP_001281145.1.7914 WP_001281145.1.79143 WP_001281145.1.79178 WP_001281145.1.79192 WP_001281145.1.79275 WP_001281145.1.79285 WP_001281145.1.79378 WP_001281145.1.79552 WP_001281145.1.79581 WP_001281145.1.79627 WP_001281145.1.79664 WP_001281145.1.79677 WP_001281145.1.79731 WP_001281145.1.79763 WP_001281145.1.7981 WP_001281145.1.79815 WP_001281145.1.79904 WP_001281145.1.79949 WP_001281145.1.80009 WP_001281145.1.80013 WP_001281145.1.80029 WP_001281145.1.80086 WP_001281145.1.80119 WP_001281145.1.80120 WP_001281145.1.80122 WP_001281145.1.80146 WP_001281145.1.80178 WP_001281145.1.80184 WP_001281145.1.80210 WP_001281145.1.80244 WP_001281145.1.80274 WP_001281145.1.80316 WP_001281145.1.80361 WP_001281145.1.80389 WP_001281145.1.8040 WP_001281145.1.80434 WP_001281145.1.8045 WP_001281145.1.80521 WP_001281145.1.80582 WP_001281145.1.80745 WP_001281145.1.80899 WP_001281145.1.81022 WP_001281145.1.81049 WP_001281145.1.81052 WP_001281145.1.81095 WP_001281145.1.81151 WP_001281145.1.81172 WP_001281145.1.81176 WP_001281145.1.81184 WP_001281145.1.81214 WP_001281145.1.81228 WP_001281145.1.81232 WP_001281145.1.81288 WP_001281145.1.81290 WP_001281145.1.81379 WP_001281145.1.81508 WP_001281145.1.81574 WP_001281145.1.8160 WP_001281145.1.81604 WP_001281145.1.81619 WP_001281145.1.81645 WP_001281145.1.8180 WP_001281145.1.81837 WP_001281145.1.81838 WP_001281145.1.8185 WP_001281145.1.81969 WP_001281145.1.81990 WP_001281145.1.8206 WP_001281145.1.82103 WP_001281145.1.8213 WP_001281145.1.82174 WP_001281145.1.82184 WP_001281145.1.82253 WP_001281145.1.82281 WP_001281145.1.82301 WP_001281145.1.82349 WP_001281145.1.82406 WP_001281145.1.82458 WP_001281145.1.82468 WP_001281145.1.82525 WP_001281145.1.82535 WP_001281145.1.82558 WP_001281145.1.8266 WP_001281145.1.82678 WP_001281145.1.82768 WP_001281145.1.82824 WP_001281145.1.82855 WP_001281145.1.82930 WP_001281145.1.82941 WP_001281145.1.83046 WP_001281145.1.83054 WP_001281145.1.83086 WP_001281145.1.83103 WP_001281145.1.8318 WP_001281145.1.83203 WP_001281145.1.83291 WP_001281145.1.83359 WP_001281145.1.83405 WP_001281145.1.83417 WP_001281145.1.8346 WP_001281145.1.83467 WP_001281145.1.83472 WP_001281145.1.83479 WP_001281145.1.83520 WP_001281145.1.83553 WP_001281145.1.8366 WP_001281145.1.83674 WP_001281145.1.83728 WP_001281145.1.83750 WP_001281145.1.83756 WP_001281145.1.83758 WP_001281145.1.83788 WP_001281145.1.83797 WP_001281145.1.83844 WP_001281145.1.8385 WP_001281145.1.83886 WP_001281145.1.83989 WP_001281145.1.84025 WP_001281145.1.84054 WP_001281145.1.84118 WP_001281145.1.84129 WP_001281145.1.84161 WP_001281145.1.84188 WP_001281145.1.84275 WP_001281145.1.84415 WP_001281145.1.84418 WP_001281145.1.84590 WP_001281145.1.84596 WP_001281145.1.84608 WP_001281145.1.8462 WP_001281145.1.84648 WP_001281145.1.84651 WP_001281145.1.84696 WP_001281145.1.84826 WP_001281145.1.84847 WP_001281145.1.84854 WP_001281145.1.84924 WP_001281145.1.84943 WP_001281145.1.8496 WP_001281145.1.84978 WP_001281145.1.85017 WP_001281145.1.85026 WP_001281145.1.85045 WP_001281145.1.85070 WP_001281145.1.85118 WP_001281145.1.85229 WP_001281145.1.85289 WP_001281145.1.85375 WP_001281145.1.85376 WP_001281145.1.85409 WP_001281145.1.85441 WP_001281145.1.85485 WP_001281145.1.85585 WP_001281145.1.85611 WP_001281145.1.85730 WP_001281145.1.85732 WP_001281145.1.85858 WP_001281145.1.85906 WP_001281145.1.85924 WP_001281145.1.85980 WP_001281145.1.86036 WP_001281145.1.86042 WP_001281145.1.86086 WP_001281145.1.86209 WP_001281145.1.86281 WP_001281145.1.86315 WP_001281145.1.8636 WP_001281145.1.86363 WP_001281145.1.86390 WP_001281145.1.86473 WP_001281145.1.86531 WP_001281145.1.86664 WP_001281145.1.86704 WP_001281145.1.86736 WP_001281145.1.86745 WP_001281145.1.86779 WP_001281145.1.86793 WP_001281145.1.86795 WP_001281145.1.8690 WP_001281145.1.86968 WP_001281145.1.86999 WP_001281145.1.87088 WP_001281145.1.87097 WP_001281145.1.87100 WP_001281145.1.87133 WP_001281145.1.87137 WP_001281145.1.87168 WP_001281145.1.87190 WP_001281145.1.87204 WP_001281145.1.87221 WP_001281145.1.87296 WP_001281145.1.87363 WP_001281145.1.87372 WP_001281145.1.87388 WP_001281145.1.87486 WP_001281145.1.87511 WP_001281145.1.87541 WP_001281145.1.87595 WP_001281145.1.8764 WP_001281145.1.87734 WP_001281145.1.87745 WP_001281145.1.87782 WP_001281145.1.87841 WP_001281145.1.87854 WP_001281145.1.87865 WP_001281145.1.87937 WP_001281145.1.87967 WP_001281145.1.88169 WP_001281145.1.88309 WP_001281145.1.88375 WP_001281145.1.88418 WP_001281145.1.88430 WP_001281145.1.88440 WP_001281145.1.8847 WP_001281145.1.88563 WP_001281145.1.88585 WP_001281145.1.8859 WP_001281145.1.88600 WP_001281145.1.88614 WP_001281145.1.88696 WP_001281145.1.88771 WP_001281145.1.88781 WP_001281145.1.88843 WP_001281145.1.88878 WP_001281145.1.88954 WP_001281145.1.88960 WP_001281145.1.88962 WP_001281145.1.89012 WP_001281145.1.89024 WP_001281145.1.89036 WP_001281145.1.89125 WP_001281145.1.89164 WP_001281145.1.8918 WP_001281145.1.89184 WP_001281145.1.89262 WP_001281145.1.89290 WP_001281145.1.89348 WP_001281145.1.89350 WP_001281145.1.89390 WP_001281145.1.89404 WP_001281145.1.89433 WP_001281145.1.89779 WP_001281145.1.89794 WP_001281145.1.898 WP_001281145.1.89863 WP_001281145.1.89908 WP_001281145.1.89949 WP_001281145.1.89950 WP_001281145.1.90069 WP_001281145.1.90173 WP_001281145.1.90174 WP_001281145.1.90217 WP_001281145.1.90246 WP_001281145.1.90250 WP_001281145.1.90386 WP_001281145.1.90447 WP_001281145.1.90454 WP_001281145.1.90475 WP_001281145.1.90488 WP_001281145.1.90506 WP_001281145.1.90533 WP_001281145.1.90556 WP_001281145.1.90661 WP_001281145.1.90698 WP_001281145.1.9076 WP_001281145.1.91005 WP_001281145.1.91019 WP_001281145.1.91150 WP_001281145.1.9122 WP_001281145.1.91280 WP_001281145.1.91287 WP_001281145.1.91371 WP_001281145.1.91447 WP_001281145.1.91486 WP_001281145.1.91525 WP_001281145.1.91530 WP_001281145.1.9155 WP_001281145.1.91586 WP_001281145.1.91611 WP_001281145.1.91634 WP_001281145.1.91670 WP_001281145.1.917 WP_001281145.1.91704 WP_001281145.1.91745 WP_001281145.1.91848 WP_001281145.1.91918 WP_001281145.1.92125 WP_001281145.1.92186 WP_001281145.1.92212 WP_001281145.1.92228 WP_001281145.1.92244 WP_001281145.1.92249 WP_001281145.1.92303 WP_001281145.1.92391 WP_001281145.1.92405 WP_001281145.1.92415 WP_001281145.1.92425 WP_001281145.1.9247 WP_001281145.1.92479 WP_001281145.1.92512 WP_001281145.1.92667 WP_001281145.1.92674 WP_001281145.1.92718 WP_001281145.1.92765 WP_001281145.1.92795 WP_001281145.1.9286 WP_001281145.1.9296 WP_001281145.1.92965 WP_001281145.1.92997 WP_001281145.1.93047 WP_001281145.1.93071 WP_001281145.1.93147 WP_001281145.1.93197 WP_001281145.1.93243 WP_001281145.1.93254 WP_001281145.1.93260 WP_001281145.1.93378 WP_001281145.1.93471 WP_001281145.1.93567 WP_001281145.1.93579 WP_001281145.1.93708 WP_001281145.1.93758 WP_001281145.1.93762 WP_001281145.1.93775 WP_001281145.1.93890 WP_001281145.1.94 WP_001281145.1.94053 WP_001281145.1.94080 WP_001281145.1.94122 WP_001281145.1.94123 WP_001281145.1.94130 WP_001281145.1.94242 WP_001281145.1.94245 WP_001281145.1.94248 WP_001281145.1.94268 WP_001281145.1.94287 WP_001281145.1.9430 WP_001281145.1.94320 WP_001281145.1.94324 WP_001281145.1.94337 WP_001281145.1.94341 WP_001281145.1.94484 WP_001281145.1.94505 WP_001281145.1.94536 WP_001281145.1.9455 WP_001281145.1.947 WP_001281145.1.94825 WP_001281145.1.94969 WP_001281145.1.95008 WP_001281145.1.95023 WP_001281145.1.95029 WP_001281145.1.95033 WP_001281145.1.95156 WP_001281145.1.95193 WP_001281145.1.95263 WP_001281145.1.95281 WP_001281145.1.95294 WP_001281145.1.95386 WP_001281145.1.95415 WP_001281145.1.9544 WP_001281145.1.95494 WP_001281145.1.95512 WP_001281145.1.95519 WP_001281145.1.95522 WP_001281145.1.95560 WP_001281145.1.9563 WP_001281145.1.95683 WP_001281145.1.95780 WP_001281145.1.95804 WP_001281145.1.95832 WP_001281145.1.959 WP_001281145.1.95962 WP_001281145.1.96160 WP_001281145.1.96163 WP_001281145.1.96209 WP_001281145.1.96218 WP_001281145.1.96271 WP_001281145.1.96305 WP_001281145.1.96316 WP_001281145.1.96468 WP_001281145.1.96568 WP_001281145.1.96646 WP_001281145.1.96688 WP_001281145.1.96727 WP_001281145.1.96770 WP_001281145.1.96804 WP_001281145.1.96895 WP_001281145.1.96918 WP_001281145.1.9695 WP_001281145.1.96976 WP_001281145.1.97001 WP_001281145.1.97007 WP_001281145.1.97072 WP_001281145.1.97117 WP_001281145.1.97138 WP_001281145.1.97191 WP_001281145.1.97267 WP_001281145.1.97295 WP_001281145.1.97411 WP_001281145.1.97466 WP_001281145.1.97536 WP_001281145.1.97574 WP_001281145.1.97627 WP_001281145.1.97731 WP_001281145.1.97739 WP_001281145.1.97758 WP_001281145.1.97786 WP_001281145.1.97827 WP_001281145.1.97835 WP_001281145.1.9789 WP_001281145.1.97899 WP_001281145.1.97928 WP_001281145.1.97999 WP_001281145.1.98011 WP_001281145.1.98033 WP_001281145.1.98051 WP_001281145.1.98191 WP_001281145.1.98242 WP_001281145.1.98360 WP_001281145.1.98361 WP_001281145.1.98379 WP_001281145.1.98411 WP_001281145.1.98456 WP_001281145.1.98552 WP_001281145.1.986 WP_001281145.1.98655 WP_001281145.1.98706 WP_001281145.1.98767 WP_001281145.1.98837 WP_001281145.1.98858 WP_001281145.1.98874 WP_001281145.1.98967 WP_001281145.1.99009 WP_001281145.1.99025 WP_001281145.1.99155 WP_001281145.1.99171 WP_001281145.1.99249 WP_001281145.1.99280 WP_001281145.1.99359 WP_001281145.1.9936 WP_001281145.1.99405 WP_001281145.1.99430 WP_001281145.1.99459 WP_001281145.1.99492 WP_001281145.1.99494 WP_001281145.1.99519 WP_001281145.1.99536 WP_001281145.1.99538 WP_001281145.1.99564 WP_001281145.1.99569 WP_001281145.1.9960 WP_001281145.1.99631 WP_001281145.1.99638 WP_001281145.1.99686 WP_001281145.1.99759 WP_001281145.1.99802 WP_001281145.1.99850 WP_001281145.1.99860 WP_001281145.1.9987 WP_001281145.1.99888 WP_001281145.1.99926 WP_001281145.1.99956 WP_001281145.1.99979 WP_001281145.1.99985 YP_500784.1.76163 gi|379015198|ref|YP_005291434.1| gi|57650742|ref|YP_186876.1| 426430.NWMN_1975 451515.SAUSA300_2027 451516.USA300HOU_2065 93061.SAOUHSC_02305 93062.SACOL2060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]