SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158311929|ref|YP_001504437.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158311929|ref|YP_001504437.1|
Domain Number 1 Region: 20-88
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000143
Family Paired domain 0.052
Further Details:      
 
Weak hits

Sequence:  gi|158311929|ref|YP_001504437.1|
Domain Number - Region: 72-118
Classification Level Classification E-value
Superfamily SCP-like 0.0612
Family Micothiol-dependent maleylpyruvate isomerase C-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158311929|ref|YP_001504437.1|
Sequence length 160
Comment hypothetical protein Franean1_0064 [Frankia sp. EAN1pec]
Sequence
MSRRATAITLTREVRAVLAGRVRSSTVPRRDWLRAAIVLAAADGVPNTTIATDLGVCEDT
VGKWRGRFAREGLAGLADRPRSGRPARCRSPRSRRRRVPGPRTSVRRWNAGRTVNSPATR
PDRASWRACRRRRSGAGWPVTRSAPGSTDRGSSPEIRRSS
Download sequence
Identical sequences A8LB70
gi|158311929|ref|YP_001504437.1| 298653.Franean1_0064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]