SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158311983|ref|YP_001504491.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158311983|ref|YP_001504491.1|
Domain Number 1 Region: 216-280,310-380
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.35e-24
Family Universal stress protein-like 0.0065
Further Details:      
 
Domain Number 2 Region: 36-176
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1e-20
Family Universal stress protein-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158311983|ref|YP_001504491.1|
Sequence length 381
Comment UspA domain-containing protein [Frankia sp. EAN1pec]
Sequence
MTDGALTGTQADQTPERTGAPAIERHSGPTVGTAADIVVGIDGSPGSAAALTWAVAEASR
RGLRVRAVLGSCADEQPTAVRRSADAIAGPHDEATLAFAASHLLHETIGAAPIPAGLEVL
EEVVDAPGAEALLTAGRDAAMIVVGARGRGLLHRLRLGSVSTSVAVHSPVPVVVARLPRS
GDAGEPDADGLAGAGPVADERLSPTSAPRQGTPHRRPVVVGVDGSPNSLAALRWAAVTAA
LRGAPLHVIHSWLAAVPLPFAETSGEIVQALEGQARAVLDESIEQVLGPIPGGEPGEPAE
PGGTEPAVLRLAAPAPGSGEIDVYRQLIPASATRALLEASHDADLLVVGARGKGGFAELL
LGSVSHQTMLHSAAPVAIIRA
Download sequence
Identical sequences A8LCE6
298653.Franean1_0118 gi|158311983|ref|YP_001504491.1| WP_012157562.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]