SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158311999|ref|YP_001504507.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158311999|ref|YP_001504507.1|
Domain Number 1 Region: 16-283
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-80
Family Protein kinases, catalytic subunit 0.0000000364
Further Details:      
 
Weak hits

Sequence:  gi|158311999|ref|YP_001504507.1|
Domain Number - Region: 568-598
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0275
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158311999|ref|YP_001504507.1|
Sequence length 700
Comment PASTA sensor-containing serine/threonine protein kinase [Frankia sp. EAN1pec]
Sequence
MTDVTDRYEAQPRLVGERYELGGCIGYGGMAEVYRGRDIRLGREVAVKTLRADLARDPTF
LARFRREAQSSASLNHPAIVSVYDTGEDVINGTQLPYIVMEFIAGQTLRDVLQAQGALDE
RHAMQVTAEVCAALDYSHRMGIIHRDIKPANVMLASDGSAKVMDFGIARATTATTSNMTA
TSAVIGTAQYLSPEQARGARVDTRSDVYSTGVLLYELLTGEPPFRGDNPVAVAYQHVREI
PPPPSSHDSRISPEADAVVLKAMEKDPDDRYATAGEMRDDLERALSGHRVHAMMMGAGDE
TMLGGAGAGTAGTALLGRSGGGYDDRYEGGGYQGRYDDGYDEPGGYDDGYGEQTRVRGEP
YDRYDQTGPVDRYGNAGPPGHRPGDDRDREGSSTWKFVLAGLGAVVVFVVVALLASSLLG
GGGGGDDTAAAQVTIPSGLKGQPYDAVVGRLQSEGFTGHFDKQTQESTDVAPNSVLEISP
GEGQTIAADGTISITVAIAPGQVTVPQGLAGMTQQAATDALTALGLQASPMQYYEAANHG
VGKVEKTEPEAGRPVDSGSSVTIWVVSSTVNVPNVKGKNASAAISELQRYGLTAVQETVV
DNASQPGTVSDQSPAGGAVNRGSSVKIFIAAQNQQPATPTATATTPPPTDTPPVIIDPTT
PPATTPPATATQPAGGGTPTNGQQPGAAGPLRGALNRPSS
Download sequence
Identical sequences A8LCG2
WP_012157578.1.9268 gi|158311999|ref|YP_001504507.1| 298653.Franean1_0134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]