SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158312025|ref|YP_001504533.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158312025|ref|YP_001504533.1|
Domain Number 1 Region: 1-194,281-317
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.46e-22
Family FAD-linked reductases, N-terminal domain 0.022
Further Details:      
 
Weak hits

Sequence:  gi|158312025|ref|YP_001504533.1|
Domain Number - Region: 240-273
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0785
Family L-aminoacid/polyamine oxidase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158312025|ref|YP_001504533.1|
Sequence length 319
Comment hypothetical protein Franean1_0160 [Frankia sp. EAN1pec]
Sequence
MAKVIVAGGGIAGVACARELRARGISVEVRDRGRVIGGRMASRWIDGRIVDAGASYFTAR
SPEFLEVVDDWLIRGLVRPWTHRFPVIDGPSATLSEPVPGPLRYAAPHGIRSLVADLATR
GGLRVSQSSPIGMVRPGPVVDGEPVDAVVLAMPDPQALRHLDPDLDTERTELIGRRWSPA
LALLAGWEARGWPPLDGAFVHGDPTVVWIADDGRRRGDNAPVLVAHSTAEFAAGRLTDPR
AAAGDLTAALRRLLGIPTDPVWTYVQRWTFARPEQPRERTYFLGQARVGLAGDGWGEPRV
ESAWRSGTELARAIAEAVG
Download sequence
Identical sequences A8LCI8
WP_012157604.1.9268 298653.Franean1_0160 gi|158312025|ref|YP_001504533.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]