SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158312171|ref|YP_001504679.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158312171|ref|YP_001504679.1|
Domain Number 1 Region: 10-223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.73e-38
Family Extended AAA-ATPase domain 0.00053
Further Details:      
 
Weak hits

Sequence:  gi|158312171|ref|YP_001504679.1|
Domain Number - Region: 336-396
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 0.00731
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158312171|ref|YP_001504679.1|
Sequence length 418
Comment DNA polymerase III subunit delta' [Frankia sp. EAN1pec]
Sequence
MHDNDGVTVWDTLVGQDAVVATLTAAATAAALVTEGGSLAAARAGMTHSWLFTGPAGSGL
ADAARAFAAGLLCENIPPGCGQCPGCHTVLSDTAADLRTVRPEGLSIGVRDVRALIRDAA
SAPSAGRWRILLIEDADRFTDSAANALLKALEEPAERAVFLLCAPSVDDVLPTIRSRCRS
VALRLPNPKNVADVLIREGTAEDLAAVLAQASQGHVGQARRLATDPQARARRESVLRLPS
RLRRVGDCLAAAADLVDAANADAQAANAERDEVETEALKTALGVGATSSGTRSTSARGAK
AGAKPRSLQVRGAAGALKELERTQKSRGRRTVLDSLDRALVDLAGLYRDVLVQQLRGQVT
PVHLDQADAVAQLAAAATPEQTLRRWEAVLATRQALADNPGLVPQLAAESLALTLRDA
Download sequence
Identical sequences A8LF28
298653.Franean1_0307 WP_012157750.1.9268 gi|158312171|ref|YP_001504679.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]