SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158312281|ref|YP_001504789.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158312281|ref|YP_001504789.1|
Domain Number 1 Region: 44-135
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000000386
Family Tetracyclin repressor-like, C-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158312281|ref|YP_001504789.1|
Sequence length 195
Comment hypothetical protein Franean1_0418 [Frankia sp. EAN1pec]
Sequence
MVGPLRTTPPPRDPSRRLRRRLCRDQRRSAATEVDADAFRVGAGPRFITTQHWRLTQRFP
QDMARAIQPITDLIAGELRAGQAAGLLHSTDPDRDAALINKMLMAVYHHQTFAAGDETIE
SVAAHLWAFCLKGIGGPIPVDAAETTARAWPSSSTAVRGRTPGARAGQLKRGPLTSSTRM
SPESTSRAQPGHADR
Download sequence
Identical sequences A8LGE4
gi|158312281|ref|YP_001504789.1| 298653.Franean1_0418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]