SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158312304|ref|YP_001504812.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158312304|ref|YP_001504812.1|
Domain Number 1 Region: 185-339
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.32e-18
Family Retroviral integrase, catalytic domain 0.032
Further Details:      
 
Domain Number 2 Region: 87-165
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000735
Family Paired domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158312304|ref|YP_001504812.1|
Sequence length 368
Comment integrase catalytic subunit [Frankia sp. EAN1pec]
Sequence
MPAGQGPHRAGWMVMVWSLLYALTRNALGLMLLRVRGDTAKDVELLVLRHQVAVLRRQVN
RPALEPADRVILAALSRLLPRAGWGSFFVTPATVLRWHRELLARKWTYPRKTPGRPPVRR
EIRELVLRLARENPTWGHRRIQGELIGLGYPVGVATVWRILHRAGVDPAPRRADASWRTF
LSAQASGLLACDFFMVDTVFLQRIYVFFVVEHATRRVHVLGVTKHPTSAWVTQRARNLLM
DLDERCHRFRFLIRDRDMKFTASFDAVFIGAGIDVVRTPPQAPKANAIAERWVGTARREC
TDRLLIVSERHLTSVLTTYAEHFNTHRPHRSLGQHPPDSPPVVAPTLESTVRRTRILGGM
INEYRNAA
Download sequence
Identical sequences A8LGG7
WP_012157882.1.9268 298653.Franean1_0441 gi|158312304|ref|YP_001504812.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]