SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158312445|ref|YP_001504953.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158312445|ref|YP_001504953.1|
Domain Number 1 Region: 8-502
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 1.7e-107
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.0000769
Further Details:      
 
Domain Number 2 Region: 561-671
Classification Level Classification E-value
Superfamily ADC-like 5.65e-22
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158312445|ref|YP_001504953.1|
Sequence length 671
Comment molybdopterin oxidoreductase [Frankia sp. EAN1pec]
Sequence
MTEISVTDTRTVRSFCRICTSVCGILVETAGDKVVRVRGDRDHPLSRGYTCPKGRSLPQM
HHHPDRIERPLMKVDGELRPTTWEECLDDLGARLRNIIERYGPESVGVFFGSGIGMDAAG
YRMAQALHAAIGTPAKFSPMTIDGTAKVLTADLVGGSPALSGRPDYDNASFVLFVGSNPV
VSHGHTVAMPNPTGTLRALRERAEVWVIDPRHTETARLAGHHLAPRPGTDYAVLAYLVRE
ILRDGADREMLSRHTQGGEILAAAVEPFTLEHAARIADVSADELAALLAGVRRAGRVAIE
TGTGVTMASSANVTQWLAWSLMIITGSMNQPGGAWFHPGFKNQLEAFKLPISPPEGSFGP
GPRSRPETQSFLGEWPCAVLADEIRAGNIRAVLNLGGHLVAAFPDTETLVPALRDLELFA
TIEIIGNETTALSTHVLPTKDQLERADVSLWDFLIQRVAVQHTPAVVEPVGDRRSVWWVL
AELGQRLGYQLADSRSGQVTDDTLLAEITAHARRPFGEVVSEGWVEVPREIPAPWVDGHV
ERMGGWRLAPRLLVDQLAALQPPAPLVLTPRRQKRHLNSQFDYLGEQPEIILHPDDAAAA
GVVDSQPVTVRSTSGEITGIAKVDGTIRRGAVSIPHGHQSANVNRLTDKSQVDIVTGMVR
YCGIPVSVHPA
Download sequence
Identical sequences A8KXE4
WP_020458240.1.9268 298653.Franean1_0588 gi|158312445|ref|YP_001504953.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]