SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158312485|ref|YP_001504993.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158312485|ref|YP_001504993.1|
Domain Number - Region: 2-45
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0534
Family Tetracyclin repressor-like, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158312485|ref|YP_001504993.1|
Sequence length 63
Comment TetR family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MADGALPGHVDAARLARLAQSLVSEGARHWATGAYAPRSFADVVTEDITALIAGFSQPPP
PPA
Download sequence
Identical sequences A8KYJ1
gi|158312485|ref|YP_001504993.1| 298653.Franean1_0628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]