SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158312573|ref|YP_001505081.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158312573|ref|YP_001505081.1|
Domain Number 1 Region: 205-255
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000762
Family AraC type transcriptional activator 0.012
Further Details:      
 
Domain Number 2 Region: 23-126
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.0000000000285
Family TM1287-like 0.037
Further Details:      
 
Domain Number 3 Region: 153-202
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000599
Family Tetracyclin repressor-like, N-terminal domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158312573|ref|YP_001505081.1|
Sequence length 273
Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MVDMRRGARVLGGSHHYEGDRLVTGWHSHDLHQIEYAISGMVEVETAGTHYLLPPRQAAW
IPAGLEHRVTINSAVRSIAVLFDPRLIDRPGDRARILAAPPLVREMMIYARRWPITRPSG
DPVSDGFFRTLGHLVVEALGHEAPLSLPTSTDPVVAAAISYTQRHLDAVSVAEVGRAVGV
SERTLRRLFRTALGLSWRHYLVQARLLRAMALLADPTRSVLEVSTAVGFESPSAFARAFA
QYCGERPSAYRQRIGVVPPALAPVGRRPHRGGR
Download sequence
Identical sequences A0A1S1RKY2 A8KZU1
WP_020458368.1.13248 WP_020458368.1.9268 gi|158312573|ref|YP_001505081.1| 298653.Franean1_0717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]