SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158312685|ref|YP_001505193.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158312685|ref|YP_001505193.1|
Domain Number 1 Region: 34-184,241-319,567-831
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.71e-105
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000333
Further Details:      
 
Domain Number 2 Region: 316-570
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 6.91e-37
Family ValRS/IleRS/LeuRS editing domain 0.0000212
Further Details:      
 
Domain Number 3 Region: 826-1015
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 4.49e-28
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158312685|ref|YP_001505193.1|
Sequence length 1016
Comment leucyl-tRNA synthetase [Frankia sp. EAN1pec]
Sequence
MSETTERGPAAVPAGTAAGDGDLPHRYDSRLAAEIERHWQQRWLREGTFESPNPTGPLSE
GFEAVRGRDPFYVLDMFPYPSGTGLHVGHPLGYIGSDVFARFLRMTGRHVLHTFGYDAFG
LPAEQYAINTGQHPRVTTEANIANMRRQLSRLGLGHDTRREIATTDTAYYRWTQWIFLKI
FDSWYDEAAGRARPISELVEELDAGHRAATGPGTAEANPRQAAWSELTATERRRVVDAHR
LTYISEELVNWCPGLGTVLANEEVTPEGRSDIGNYPVYRRPLRQWMMRITAYADRLMSDL
DLVDWPDSIKHMQRNWIGPSDGATVRFSTVTGAGDTAGAGGVDAPVGPAPIDVEVYTTRP
DTLPGATFLVLAPEHPLVDALTATSWPADTPAGWRFAQERPAGVTDGEWTPQAAVDAYRA
FAARRSDRQRGGTEIDRTGVFTGTYVRNPVGGGVIPVFLADYVLLGYGTGAIMAVPAHDE
RDFSFAQEFGLPIPAVLEPDEAWLAERDLAAGAPASSWPEAFSGEGSYLAGATDRPVLAG
LSKADAIKTTISWLEDAGRGRATRSYRLRDWLFSRQRYWGEPFPIVFDDDGMPRAVPEEQ
LPVELPEMTDFRPKAMADDDESEPVPPLARATEWTTVTLDLGDGPRGYRRELNTMPQWAG
SCWYYLRYLDPTNSERFVDPAVERYWMHSERGPAGDGGVDLYVGGVEHAVLHLLYARFWH
KVLYDLGLVSTREPFKRLYNQGYIQADAFTDERGMYVPATEVVQGADGSFSHEGAPVNRR
SGKMGKSLKNSVSPDEMYDSYGADTLRVYEMAMGPLDAHRPWRTDDIVGSYRFLQRLWRN
IIDEGTGEPRVRAAALDDETAQALHRTILAVRADYAELRFNTAVARLIELTNLASKRFGA
GLDGPPRELAEALVLMAAPLAPHIAEELWTRLGHTGSVCAVPFPEGDESLAAAATVRLPV
QVNGKVRFTIDVPADADEAAVRAVLEAHADYTRHTSGRTIKRLIVVPGRIVNIALG
Download sequence
Identical sequences A8L171
WP_020458479.1.9268 298653.Franean1_0829 gi|158312685|ref|YP_001505193.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]