SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158312686|ref|YP_001505194.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158312686|ref|YP_001505194.1|
Domain Number 1 Region: 195-541
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 4.13e-72
Family CPF0428-like 0.094
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-28
Family Thioltransferase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158312686|ref|YP_001505194.1|
Sequence length 669
Comment hypothetical protein Franean1_0830 [Frankia sp. EAN1pec]
Sequence
MPNKLAEQTSPYLLQHADNPVDWWPWGPEAFAEATTRGVPVLLSVGYAACHWCHVMAHES
FEDPEIAAYMNQHFVNIKVDREERPDVDSVYMDVTVALTGHGGWPMTVFLTPAAEPFFAG
TYFPPRPMRGSASFPQVMAAIVDAWTARRAEVEQSGADIARQLAEAVAPGGAASGGGATT
QITADLLDRAVAGLADRFDSVHGGFGGAPKFPPSMVAEMLLRSWARTGDGRALGMVRETC
ERMARGGMYDQLGGGFARYSVDESWTVPHFEKMLYDNAQLLRVYLHLWRATGLPLAERVV
RETAAFLLADLRTPEGGFASALDADAVPAGSPGGHPEEGASYSWTPAQLVDVLGPDDGAL
AARVLGVTAEGSFEHGTSVLMLPADPEDPARFARVRAALAAARATRPQPARDDKIVAAWN
GLVIGALAEAGALLGEPSWVGAAERAAELLRDVHLHEGRLWRTSRDGRRGPNAGVLEDYG
CVAEGFLTLHQVTGAAGWLALAGELLDVVRARFAAPDGGYFDTADDAEALLRRPRDASDS
ATPSGQAAVAGALLTYAALTGSADHRDSARATVEQLTPLLSRDARFAGWAGAVAEALLAG
PAEVAVVGRPDLERLARLGTAPGAVVVTEGPLTAGRDEPAVYICRDFVCELPARTPEEVR
ARLGVRLPA
Download sequence
Identical sequences A8L172
WP_020458480.1.9268 298653.Franean1_0830 gi|158312686|ref|YP_001505194.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]