SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158312788|ref|YP_001505296.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158312788|ref|YP_001505296.1|
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.84e-17
Family Thioltransferase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158312788|ref|YP_001505296.1|
Sequence length 79
Comment glutaredoxin-like protein [Frankia sp. EAN1pec]
Sequence
MLTMYTTPWCGYCVRLKGQLDRAGVEYVTVDIEQDPTAEQLVRDANNGNATVPTVVFPDG
TVMTNPTLRQVTEKVTSAA
Download sequence
Identical sequences A8L2J7
298653.Franean1_0934 WP_018502246.1.66809 WP_018502246.1.9268 gi|158312788|ref|YP_001505296.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]