SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158312929|ref|YP_001505437.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158312929|ref|YP_001505437.1|
Domain Number 1 Region: 192-314
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.36e-50
Family C-terminal domain of the electron transfer flavoprotein alpha subunit 0.00000974
Further Details:      
 
Domain Number 2 Region: 4-172
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.37e-37
Family ETFP subunits 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158312929|ref|YP_001505437.1|
Sequence length 320
Comment electron transfer flavoprotein subunit alpha [Frankia sp. EAN1pec]
Sequence
MAEVLVLVEHSDGEPKKVTAELLTLARTIGEPSAVFLGGPGSYAKAKEYLAQYGAAKVYL
VESEDVADYIGAPAAEVLSKLVADVSPVAVLAAATPDSREVAARTAARTDSGLIWDATAL
TSDLTATQGIFGGSTIVNSKVTKGTPIVVVRPNSTAPEAAPTTPVETPVDIAISDAAKGA
KIVDRVVEAKSGRPDLTEAQIVVSGGRGLGAAEHFALVEKLADTLGAAVGASRAATDAGW
YPHQHQVGQTGKTVSPQLYIAVGISGAIQHRAGMQTSKTIVAVNKDPEAPIFEFADYGLV
GDLFNVVPQLTEEIQKHKAG
Download sequence
Identical sequences A8L531
298653.Franean1_1075 WP_020458712.1.9268 gi|158312929|ref|YP_001505437.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]