SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158313014|ref|YP_001505522.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158313014|ref|YP_001505522.1|
Domain Number 1 Region: 112-255
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 4.45e-41
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000145
Further Details:      
 
Domain Number 2 Region: 59-110
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000138
Family TS-N domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158313014|ref|YP_001505522.1|
Sequence length 259
Comment translation elongation factor Ts [Frankia sp. EAN1pec]
Sequence
MRLSGRATPGRTDVDRRGRATSGPGGASARRRRVCFGAETERPPSPAIGTDEKSTMADIT
AADIRKLRELTGAGMSDVKKALVDHDGDFEKAKSWLREKGLAQVAKRAGRSTANGLVESY
LHRTDPQLPPTLGVLIELRCETDFVAKTDDFKQLARDLAQHIAAADPLYVTAEQIPNEVL
EQERKIYEAAAREEGKNDKAIPKIVEGRVNGYVKSVVLLDQPWVKDGKLTIRALLEQAGS
ALGEKIEVGRFARFNIKQA
Download sequence
Identical sequences A8L6D4
298653.Franean1_1162 gi|158313014|ref|YP_001505522.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]