SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158313265|ref|YP_001505773.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158313265|ref|YP_001505773.1|
Domain Number 1 Region: 19-99
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000889
Family Apolipoprotein 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158313265|ref|YP_001505773.1|
Sequence length 140
Comment hypothetical protein Franean1_1425 [Frankia sp. EAN1pec]
Sequence
MARLSEQLAYLSRRAKAAEDAADVAETETREELAAKVEQARANAEQHASELREKATDVTQ
EASSRWSEIQERWKDHVSKVRAEVQQKQTERDAQRAERRAEYAEDDAVCAISFAIAAVEE
AEYAVLDATLARADAAAVST
Download sequence
Identical sequences A8L944
WP_020459041.1.9268 gi|158313265|ref|YP_001505773.1| 298653.Franean1_1425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]