SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158313315|ref|YP_001505823.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158313315|ref|YP_001505823.1|
Domain Number 1 Region: 155-205
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000332
Family AraC type transcriptional activator 0.0077
Further Details:      
 
Domain Number 2 Region: 102-152
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000118
Family Tetracyclin repressor-like, N-terminal domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158313315|ref|YP_001505823.1|
Sequence length 214
Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MTIPGAGATTELLCASYSFDQTRPHPLLHGLPQVVHLPARVGHHPDLRAAVDLLGNELRR
PRAGTEAIVPALIDMLLLYVLRAWLDEQSGHALTGWVMALNDPAISTALHHVHRHPGRPW
SVEDLAREAGLSRAAFAKRFATIVGQPPLAYLTWWRMTTAARLLRESKAPLSAVAERCGY
RSEFAFAKAFKREFGAAPGRYRRQGQPGQDPFGK
Download sequence
Identical sequences A8LA37
298653.Franean1_1477 gi|158313315|ref|YP_001505823.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]