SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158313329|ref|YP_001505837.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158313329|ref|YP_001505837.1|
Domain Number 1 Region: 8-594
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 4.45e-190
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000000618
Further Details:      
 
Domain Number 2 Region: 1003-1216
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.25e-48
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.0005
Further Details:      
 
Domain Number 3 Region: 564-708
Classification Level Classification E-value
Superfamily ADC-like 1.8e-48
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.00027
Further Details:      
 
Domain Number 4 Region: 1215-1370
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.83e-48
Family NADPH-cytochrome p450 reductase-like 0.00012
Further Details:      
 
Domain Number 5 Region: 832-971
Classification Level Classification E-value
Superfamily Flavoproteins 7.98e-38
Family Cytochrome p450 reductase N-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158313329|ref|YP_001505837.1|
Sequence length 1370
Comment molybdopterin oxidoreductase [Frankia sp. EAN1pec]
Sequence
MTTKVALDRVRTVCAYCGVGCGIVLEVDRSGDSPRVVRSTGDPDHPANRGRLCTKGATTA
ELLNAPGRLTTALARAGHDEEPAPIDVDTALDLAAARLAALRDEHGPDAIGIYTSGQLSI
EAQYLITKLAKGFLRTQYQECNSRLCMASAASGYKLSLGADAPPGSYDDFDHADVFLVIG
ANMADCHPILFLRMMDRVKAGAKLIVVDPRRTATADKADLFLQLRPGTDIALLNGLLHLL
HASGAVDESFVAAHTEGWAAMPDLLAGYDPATVADITGVPEDDLRAAAALIAAAGSWMSC
WTMGLNQSTHGTWNTNALINLHLATGAICRTGSGPFSLTGQPNAMGGREMGYMGPGLPGQ
RSLLDPADRAHIEQLWGLPADTIRADHGNGTIGMFEQMSAGAIKAAWIICTNPVATVANR
RTVIEGLETAEFVLVHEAFTETETTGYADVVLPAAVWAETDGVMVNSERNLTLTRPAADP
PGQARADWQLIAGIATRLGYADHFTYNSAQEVFDELRQAWNPVTGWDLRGITHGRLRDGP
MQWPAPPGAGARNPIRYMTDDGPRFPTPSGRAKFWPRPHVDPQEIPDEKYPYLLNTGRLQ
HQWHTLTKTGRVGRLNKLNPAPFIEIHPDDAAALGISEGDQVEVSSRRGRAVLPAAVTDR
VQPGNCFAPFHWNDMFGEYLAVNATTSDAVDPVSLQPGFKASAVALTRVHTPTPAQPPPT
LVDDVLHADAVASAAPIASLLGLGGTAAPPALNDDESVYLAGFVAGLGLDLARGALTSVP
TLPPSAPVTARTALWVNGALAGLWSRLPAEGREILPGRGVSPREDPPGTGGRRVLLGWAS
QTGNAERVAEQAEARLTESGTVVTTLPLNEIDHIAPHTDLVVVTSTFGDGESPDNGSEFL
ARLRARSMPLDDVRFSVIALGDSSYSDFCGHGRRIDELLAELGGLRLADRVDCEPDFDEA
ARAWLDRVLAARAGASPTRPEPVPVPVPPVSRLPGASSGPRVSETHRVILAGNRLLSGVG
SAKEVREFLIDLEDSDLTYETGDVLVVRPSNRAELVDEWLSTTGLRGDTIVELLQFGRTE
LAVALRDHLEIAKPSRAFLAFVAERSGSRHLQRLLRGDRADLDGWLWGRQTVDVITETGT
HASAQEWCELLKPLRERRYSISSSAEVSPRQIRTLVSVVRYNAPSGAARTGVASAFLADA
PAGTPLKVAVARSSGFAPPSDPETPTIMIGPGTGLAPFLAFLDTRRARGHTGRNWLFFGE
QRRATDFYYSDELAEFARSGLLTRLDTAFSRDQRAKIYVQDRMRERGAPLWQWLREGAAV
YVCGDAARMARDVDTALRDVVAKHGDLNAAQAGDYVRQLITDGRYLRDVY
Download sequence
Identical sequences A8LA51
WP_020459105.1.9268 gi|158313329|ref|YP_001505837.1| 298653.Franean1_1491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]