SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158313344|ref|YP_001505852.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158313344|ref|YP_001505852.1|
Domain Number 1 Region: 7-85
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000359
Family Tetracyclin repressor-like, N-terminal domain 0.0032
Further Details:      
 
Weak hits

Sequence:  gi|158313344|ref|YP_001505852.1|
Domain Number - Region: 88-211
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0445
Family Tetracyclin repressor-like, C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158313344|ref|YP_001505852.1|
Sequence length 227
Comment TetR family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MTGKAVRPERGSATRELILNTAERLFAERGVHAVSNRQVSEAAGQSNNAVVSYHFGTKAD
LVRAIARRHADQMEQVRVTLVAEAAGSADLRGWVACLVRPFTEHLAALGSPTWYARFRAQ
VVSDPALHGIAVEESLRSASLRLLLAGLNQCLPDLPADIRTVRWVMARHLIAHMCVERER
ALAEGTPTLEPSWDALAASLIDALVGLWQAPVTPAPPKENAAGKTKR
Download sequence
Identical sequences A8LA66
WP_020459120.1.9268 gi|158313344|ref|YP_001505852.1| 298653.Franean1_1506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]