SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158313441|ref|YP_001505949.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158313441|ref|YP_001505949.1|
Domain Number 1 Region: 264-319
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000627
Family AraC type transcriptional activator 0.044
Further Details:      
 
Weak hits

Sequence:  gi|158313441|ref|YP_001505949.1|
Domain Number - Region: 4-60
Classification Level Classification E-value
Superfamily Cation efflux protein cytoplasmic domain-like 0.0235
Family Cation efflux protein cytoplasmic domain-like 0.027
Further Details:      
 
Domain Number - Region: 211-251
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0258
Family ArsR-like transcriptional regulators 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158313441|ref|YP_001505949.1|
Sequence length 354
Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MATVLDLDHLPAHRRAEVARDAIVALTVTSRFSVHAQHDIRGRIESWIFGEVGLIRTTVN
AGQHMIRTARHVRQDSAPPVLSFAQRRHGRAVQEQFGVRRELAAGELYCTDLSSAFEYAN
AEGGCGQGLQVPLASLGLPGEVVRRGAPNLARSPLYPLVTDHLTALARDAAALERDESAA
GVGTATVELVRALLVSAARGPDEPPGTPAEIMLARVRHHVLAHLADSDLNADGIAAAVGV
SVRHLYRLCREAEFSLEQWIVRNRLERARGALAARDARGRSIAAIARANGFADPSHFSRR
FRAAYGTTPQEWRRHHTPHHTSPPQTPTPEPGSGPAPNPDSRSSRGAGRCVAGE
Download sequence
Identical sequences A8LBJ6
gi|158313441|ref|YP_001505949.1| 298653.Franean1_1604 WP_020459216.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]