SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158313475|ref|YP_001505983.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158313475|ref|YP_001505983.1|
Domain Number 1 Region: 205-256
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000666
Family AraC type transcriptional activator 0.025
Further Details:      
 
Domain Number 2 Region: 16-163
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.000000000356
Family TM1287-like 0.031
Further Details:      
 
Weak hits

Sequence:  gi|158313475|ref|YP_001505983.1|
Domain Number - Region: 153-204
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000207
Family AraC type transcriptional activator 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158313475|ref|YP_001505983.1|
Sequence length 270
Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MPFLPMRRCVTVGAGTVEHRADELISYWHRHDLHEVEYAVSGLAEIRTPTTHYLMPPSYA
AWVPAGVEHSPLLRNVTTIAVFFDPAVFDFPYSRAAVIPVPPVLREMMRYATRWPIGRGE
DDAEADTFFRALAAVVRGQLAHEAPLSLPTADDPVVRDVMAYTTDHLAEVTAARVCRAVG
ISERVLRRRFAAVLGQSWREYLRQVRLIRAMALLSTPTTSVGEIATEVGFGSASALARAF
RAWTGESPSAYRDRWLTTAALDDPSHLTST
Download sequence
Identical sequences A8LCQ9
298653.Franean1_1639 gi|158313475|ref|YP_001505983.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]