SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158313620|ref|YP_001506128.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158313620|ref|YP_001506128.1|
Domain Number - Region: 1-47
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0264
Family Homeodomain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158313620|ref|YP_001506128.1|
Sequence length 375
Comment IS605 family transposase OrfB [Frankia sp. EAN1pec]
Sequence
MKRAYRYRFYPTVEQAEQLARTFGCVRYVYNRALAERHRVWFQEQRRVTHAETDKMLTAW
KRDPETAWLAEPSKGPLQATLRHLQTAYVNFWEKRAGYPSFKKKGRTLDSATYFRNCFSF
RDGQVRLAKQDLPLDIAWSRPLPEGAAPSQVTVSRNTRGQYHISILVEETISSLPPSPAQ
VGVDAGVTSLVALSTGEKVTNPWHERADRARLARAQRELSRKRKGSANRARSRLTVARIH
GRIADRRRDHLHKLSTRIIRENQTVVIEDLAVRTMVRNHSLAQAISDASWSELRRMLEYK
ADWYGRTVIAVDRFYPSSRTCSACGSIVEKLPLNVREWECRCGAHHDRDVNAAKNILAAG
LAVSACGDGVRPPRS
Download sequence
Identical sequences A8LFB9
gi|158313620|ref|YP_001506128.1| 298653.Franean1_1784 WP_020459393.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]