SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158313671|ref|YP_001506179.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158313671|ref|YP_001506179.1|
Domain Number 1 Region: 17-317
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-71
Family Protein kinases, catalytic subunit 0.00000674
Further Details:      
 
Domain Number 2 Region: 597-652
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000798
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 
Weak hits

Sequence:  gi|158313671|ref|YP_001506179.1|
Domain Number - Region: 383-444
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00772
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0078
Further Details:      
 
Domain Number - Region: 523-580
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0667
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 
Domain Number - Region: 450-512
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0994
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158313671|ref|YP_001506179.1|
Sequence length 658
Comment PASTA sensor-containing serine/threonine protein kinase [Frankia sp. EAN1pec]
Sequence
MHVDSTVADPVIGRLLDGRYTAQERLAVGGMATVYVAHDNRLDRFVALKIMHPNLSHDPE
FVARFHREANAVARLNTPCAVSILDQGSDTSPAGVLHYLVMELVRGRSLRQHLGMRGRLT
VAEVVEIFEPVAEALAAAHAAGIIHRDIKPENILLGDDGRVKVADFGLARPVTNPTAALT
GGVVMGTVGYLAPEQVTHGTAGMRSDVYAAGVMLFEMITGNLPHTGETPMSVAYQSVHGD
VPAPSTVVPDVPAELDALTLRATARDPNHRPADGAALLAELRAILPYLPAPDAGEEYHSG
FTGPLVAPPRPAPPRPTAGPPVAPTSMLGTGSGSSSGGRRRAQRSGPGSRLPVGPAIIAA
VVVVCLVLGVLMLRALVGGGKPEVPLLIGLAKADAEQDLRDAGLAFTYGAEIASTQIPQG
HVVEQDPKTGAAVSDGAVVTLRLSSGAPKATVPDLAGLTVDQALPKLTEAKLADGGRSSE
ASDTVPQGQVVRTEPAAGAVVDPSTSVKLVLSSGPSSVAVPSDIIGMTFDEAKARLDSLN
LNLTVQQSNVASDSVDPGHVVRSSPGPGERVNAGGAVTLFVAQEADSGDGDGSGVMVTVP
NVVGKSWSDAERILNRLGLNADRSNWFAERVTGQSPKAGRKIEKGSTVHLKTEFRVGN
Download sequence
Identical sequences A8LFH0
298653.Franean1_1835 WP_020459442.1.9268 gi|158313671|ref|YP_001506179.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]