SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158313972|ref|YP_001506480.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158313972|ref|YP_001506480.1|
Domain Number 1 Region: 167-309
Classification Level Classification E-value
Superfamily Sortase 1.29e-30
Family Sortase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158313972|ref|YP_001506480.1|
Sequence length 323
Comment sortase family protein [Frankia sp. EAN1pec]
Sequence
MPATNRRHLADSLTDLPVQPGAGRPPAPASPTADPHLGEPAHRGARAAPGGPGRSRGARR
PGLVRHTPWPRRVQPDRVDGRRRRRNPVAGLADRPVGGRVSRGLGEVMITAGLVVVLFLA
YQLWITDIFAARTQDRLRNDLTTAWSRQPHPRAPAEAAKPRPVVPPVELGEGVAVLRVPR
FGADYAPVVVEGVSVAALRRGPGHFPGTAMPGDVGNFVVSGHRTTYGKPFSRLDELRVGD
PLVVEVADRYFTYRVTGSEVVDPHRLDVTYPVPGHAGVAPTRALMTLTTCHPRFSARSRL
IVFANLDETTDKSDGPPRALADE
Download sequence
Identical sequences A8L014
gi|158313972|ref|YP_001506480.1| 298653.Franean1_2138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]