SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158314062|ref|YP_001506570.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158314062|ref|YP_001506570.1|
Domain Number 1 Region: 16-111
Classification Level Classification E-value
Superfamily YggU-like 3.27e-17
Family YggU-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158314062|ref|YP_001506570.1|
Sequence length 121
Comment hypothetical protein Franean1_2229 [Frankia sp. EAN1pec]
Sequence
MPPGTLPAPCRRPVGDDGRVRVAIRVRPAADRTAVGPATSDPTHGRLLVVRVREPAVEGR
ANEAALRALAQALGVRRSDVTLTRSIGRVKFIEVDAPDDVITRRVEELAQHSDPAARLDS
R
Download sequence
Identical sequences A8L1D2
gi|158314062|ref|YP_001506570.1| WP_020459830.1.9268 298653.Franean1_2229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]