SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158314123|ref|YP_001506631.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158314123|ref|YP_001506631.1|
Domain Number 1 Region: 1-176
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.45e-52
Family Glutathione peroxidase-like 0.00000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158314123|ref|YP_001506631.1|
Sequence length 186
Comment alkyl hydroperoxide reductase [Frankia sp. EAN1pec]
Sequence
MLTVGDVFPAYDLTGVVSSDPDTAFIQETSTSRTGQWRVVFFWPKDFTFVCPTEIAAFGR
LNSEFADRDAQILGVSTDNEYVHLAWRQNHSDLRELPFPMLSDIKRELAVACGVLGDDGV
AQRATFVIDPDGVIQFVMVTAGSVGRNPAEVLRVLDALQTDELCPCNWQKGEATLGAAAA
PAEVAA
Download sequence
Identical sequences A8L1J3
WP_020459891.1.9268 gi|158314123|ref|YP_001506631.1| 298653.Franean1_2290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]