SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158314170|ref|YP_001506678.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158314170|ref|YP_001506678.1|
Domain Number 1 Region: 30-185
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.00000000000000182
Family TM1287-like 0.091
Further Details:      
 
Domain Number 2 Region: 213-261
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000184
Family AraC type transcriptional activator 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158314170|ref|YP_001506678.1|
Sequence length 263
Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MGVDSGGGPPPGRRVLSMNRRFLAGPELRRLTDRERIDWHDHTDHQLIYPGTGVLRVVTR
VGSWVVPPLRAVWLPAGVAHAHQAHGPTHMHSLAFSDVDDPFGSPDPTVVAVPALLREII
RALTATGLAGADRRDLTAVLLRSLRPVTELRLCLPQPRDDRLVALTAALAADPADPRTLA
ELGAAVGASERTLSRLFRRQTGMTFPQWRAQLRLHHGLTLLAGGEPVTTVAFACGYSNPS
AFTAAFRDAFGVTPARYARETRQ
Download sequence
Identical sequences A8L2S5
298653.Franean1_2338 gi|158314170|ref|YP_001506678.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]