SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158314234|ref|YP_001506742.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158314234|ref|YP_001506742.1|
Domain Number 1 Region: 36-144
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.000000000153
Family TM1287-like 0.04
Further Details:      
 
Domain Number 2 Region: 223-272
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000986
Family AraC type transcriptional activator 0.013
Further Details:      
 
Domain Number 3 Region: 171-220
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000284
Family Tetracyclin repressor-like, N-terminal domain 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158314234|ref|YP_001506742.1|
Sequence length 290
Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MTASAHSARRAPETARVSLVDVRRGGHALGGSYLYEGERLVTGWHSHDLHQIEYAVAGVV
EVETATAHYLLPPQQAAWIPAGLEHQATMNTAVRTVSVMFDPRLVPHPGDRARILAVAPL
IREMMIYALRWPIARAEHDPVADGFFQTLGHLVSEALDHEAPLSLPTSTDPIVSAAMAYT
QNHLDSVTVGEVSRAVGVSERTLRRQFRSTLGLSWRSYLLQARLLRAMALFAVPGQSVLE
VSTAVGFDNGSAFARAFSQYCGETPSSYQRRISAAPQPLTVSGTAAGQQA
Download sequence
Identical sequences A8L421
298653.Franean1_2404 WP_020459999.1.9268 gi|158314234|ref|YP_001506742.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]