SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158314278|ref|YP_001506786.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158314278|ref|YP_001506786.1|
Domain Number 1 Region: 31-297
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-58
Family Protein kinases, catalytic subunit 0.0000488
Further Details:      
 
Weak hits

Sequence:  gi|158314278|ref|YP_001506786.1|
Domain Number - Region: 429-489
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0196
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 
Domain Number - Region: 562-613
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.034
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.018
Further Details:      
 
Domain Number - Region: 496-556
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0733
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158314278|ref|YP_001506786.1|
Sequence length 641
Comment PASTA sensor-containing serine/threonine protein kinase [Frankia sp. EAN1pec]
Sequence
MDACRSAEDPVTAPGGQPAAGPLRPDDPSELGHYRVLGRLGEGGMGTVFLGAAPDGRPVA
IKMIRAEVAGVPSFRARFRREAELARRVARFCTAELLDAVDPPDGPPFIVTEFVDGPTLA
AAVAAGGPLGAADLERVAVSVAAALTAIHGAGLVHRDLKPANVLLSPLGPRVIDFGIAHA
ADITHVTRDSIVGTPAFMAPEQALAQPVSGAADVWAWAGLVTFAGTGRPPFGDGPPETQI
FRIVHGDPNLDGLDPALGAVVRRAMSRQPTDRPTAQDLLQQLVTLGVEVPASATSALALP
AADGGAPPQGRTPASDPIPPTSPAGPSGSPSAARRTRPERRPSGRMLVAALAGVVVVLVG
AWLLLQAQPPDGRDDTDTRVSAASASGDPTGPSDGQSPGSGEASPGTATATGPGPGGTAR
EVTPPGEPVEIPDVVGRPVTEAEEALRTAGLTNIIRTTRLDDRPAGSVIGMHPAAGSEVS
RDAAIELDVSDGPGHTTVPDLVGRSEVDARSGLYSAGLVMVVQENSGPSKVGPGLVERTD
PPGGTQVAYGTTVTISVASRQVAVPDVVGQSAAAATATLRDYGFDVVEERGAGSQPAGVV
IAQLPRAGLVTRGATVTITVSQPRSNGDSQVAQTPEPPPVP
Download sequence
Identical sequences A8L465
gi|158314278|ref|YP_001506786.1| WP_020460043.1.9268 298653.Franean1_2448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]