SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158314290|ref|YP_001506798.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158314290|ref|YP_001506798.1|
Domain Number 1 Region: 222-320
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.25e-19
Family FHA domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158314290|ref|YP_001506798.1|
Sequence length 325
Comment FHA domain-containing protein [Frankia sp. EAN1pec]
Sequence
MSTETGPADGDEDSPHSEGEDEPAYRPPTGWLAGPGPGRAYPTPEPSGATTQHAAGRGGT
ARRRTDPDTDDEPDEPDDVPDDPDDYADGEPADDLPAADAGIGGAGPGGPPAAAGGLALA
GSGEPPAPRAGRGRPPLGSWDPDDSFAPRFPRAEATPAHCPHCRARPAPTDRFCLRCRYE
FATGRRPVVPRVYPAPAAPPRWDAVVEVDEAHFARVIGDGVRLPEGRLPWVVHLDGPEIL
IGAGPDGPPAGVDLSGPADDPAVSGRHASLVRQPDGGYAVVDHGSLNGTRVNDSSQPIPA
GHPVSLRDGDRVFVGAWTRITIRRP
Download sequence
Identical sequences A8L477
298653.Franean1_2460 gi|158314290|ref|YP_001506798.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]