SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158314338|ref|YP_001506846.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158314338|ref|YP_001506846.1|
Domain Number 1 Region: 49-146
Classification Level Classification E-value
Superfamily Lysozyme-like 3.22e-17
Family C-type lysozyme 0.011
Further Details:      
 
Domain Number 2 Region: 199-255
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000000275
Family Peptidoglycan binding domain, PGBD 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158314338|ref|YP_001506846.1|
Sequence length 256
Comment peptidoglycan binding domain-containing protein [Frankia sp. EAN1pec]
Sequence
MSHGKHRRSSRPNTSGRGPGRGRAAVVTAASVIGASAGLMFTAGPASAATVSDVTIAQAA
QNAGLPSCRGIPLSTWVAVALAESGGNTTAHATVGEDSRGLWQINMRAHSSWVGSRNLYD
PNVNAWAARQVCASQGIGAWSAYKNGMHVKYLARGAAAAAAVGGGTGTRTISAVTPAAPA
APAPAPASSGYMRLGVEGVRWDVALVQKRLADIGYPITVDGRFGPQTNHMVVDFQKKNGL
VPDGVVGPLTHDRLFA
Download sequence
Identical sequences A8L5D0
WP_020460103.1.9268 298653.Franean1_2508 gi|158314338|ref|YP_001506846.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]