SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158314579|ref|YP_001507087.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158314579|ref|YP_001507087.1|
Domain Number 1 Region: 57-164
Classification Level Classification E-value
Superfamily Homeodomain-like 8.96e-18
Family Paired domain 0.093
Further Details:      
 
Domain Number 2 Region: 229-368
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000197
Family Retroviral integrase, catalytic domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158314579|ref|YP_001507087.1|
Sequence length 389
Comment putative transposase [Frankia sp. EAN1pec]
Sequence
MCLADPDQRIFGFVEGVHDRRIEHAIEDLGPSAEPIELSAAERAVLEGWARRRKTAQALA
LRSRIVLACADGGTNSGVAAGLGITRGTVAKWRNRFTVDRLEGLSDEERPGAPRKVTDAQ
VEAVIARTLEEKPPNGDTHWSSRSMARASGLSQSTVSRMWRAFGLKPHLVETWKLSTDPL
FVDKVRDVVGVYLDPPEKAIVLCVDEKSQVQALDRTAPVLPMMPGTPERMTHDYVRHGTT
SLFAALDPTSGSVIAQTYRRHRHQEFLRFLKLIDGSVPKGYDLHLVLDNYATHKTPAVKN
WLLRHPRFHLHFTPTSASWMNLVERWFAELTNRKLRRSTHRSVVELEADIRKWINAWNKD
PKPFVWAKTADEILETLAAYCQRISDSAH
Download sequence
Identical sequences A8L867
298653.Franean1_2758 gi|158314579|ref|YP_001507087.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]