SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158314676|ref|YP_001507184.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158314676|ref|YP_001507184.1|
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.92e-20
Family DJ-1/PfpI 0.015
Further Details:      
 
Domain Number 2 Region: 151-201
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000717
Family AraC type transcriptional activator 0.059
Further Details:      
 
Domain Number 3 Region: 103-148
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000179
Family AraC type transcriptional activator 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158314676|ref|YP_001507184.1|
Sequence length 258
Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MTGLLDGRPAATHWNHAATFSREFPAVRLDSDVLFVDDGDVLTSAGAASGVDLCLHLIRL
DQGSEVANAVARACIVAPWREGGQAQFIEAPVPDSGDASTAATREWALRRLDAGLTLASM
ARHASMSIRTFTRRFRDETGTSPNQWLTRQRIDYARRLLESTDLSIDQIADATGFGTAAS
LRGHLRNAIGVSPSAYRRTFHLRAHTGERTTTRSSASGEPGRGGDAVVLDDEPVGPQPDT
EGTAAFRGAGARQIPSIS
Download sequence
Identical sequences A8L9D9
298653.Franean1_2855 WP_020460433.1.9268 gi|158314676|ref|YP_001507184.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]