SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158314701|ref|YP_001507209.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158314701|ref|YP_001507209.1|
Domain Number 1 Region: 26-297
Classification Level Classification E-value
Superfamily Aldolase 5.13e-61
Family HMGL-like 0.0000000119
Further Details:      
 
Domain Number 2 Region: 309-356
Classification Level Classification E-value
Superfamily post-HMGL domain-like 1.18e-17
Family DmpG/LeuA communication domain-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158314701|ref|YP_001507209.1|
Sequence length 377
Comment pyruvate carboxyltransferase [Frankia sp. EAN1pec]
Sequence
MTSLSAGTSTAPDTSPDRPAEPFVPDLYVQDVTLRDGMHAVRHRYSVETARTIATALDAS
GVRAIEVAHGDGLAGSSINYGIGAHTDWEWIEAVTASVTNAIPTSLLLPGIGTVRDLRQA
HALGIRSVRVATHCTEADISAQHISAARDLGMDVAGFLMMSHMAAPAELARQARLMESYG
AHCVYVTDSGGRLTMDDVRDRFRAYSDVLDPATETGIHAHHNLGLGVANTVVAVENGATR
VDASLAGQGAGAGNCPLEAFIAVADLMGWKHGCELFGLMDTADDVVRPLQDRPVRVDRET
LTLGYAGVYSSFLRHAEAAATRYGLDTRTILAEVGRRGMVGGQEDMIVDVALDLVARATG
RGIVASAESGITAPDQS
Download sequence
Identical sequences A8LAA1
298653.Franean1_2882 gi|158314701|ref|YP_001507209.1| WP_020460455.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]