SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158314707|ref|YP_001507215.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158314707|ref|YP_001507215.1|
Domain Number 1 Region: 28-83
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000221
Family Tetracyclin repressor-like, N-terminal domain 0.015
Further Details:      
 
Weak hits

Sequence:  gi|158314707|ref|YP_001507215.1|
Domain Number - Region: 49-156
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0085
Family Outer membrane efflux proteins (OEP) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158314707|ref|YP_001507215.1|
Sequence length 203
Comment regulatory protein TetR [Frankia sp. EAN1pec]
Sequence
MEPMNPVRREAGARQYRQVRRAAAADAVTGRIMAAGLALFIERPFDQITLAAVAARADVG
LQTVIRRMGTKDGLIRAVSAWLFPTISADRSMPARIDPSEFTESMAQNYERWGEVIRRAL
HQQDAFPAFAEAVEAGRRAHRAMIEAGFAAHLDVLDPDSRSDCLGRLAAVCSLELWLLLR
NDQGLSIAAPRAAVADLISACLR
Download sequence
Identical sequences A8LAA7
298653.Franean1_2888 gi|158314707|ref|YP_001507215.1| WP_020460461.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]