SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158314787|ref|YP_001507295.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158314787|ref|YP_001507295.1|
Domain Number 1 Region: 4-280
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.37e-69
Family TauD/TfdA-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158314787|ref|YP_001507295.1|
Sequence length 281
Comment taurine catabolism dioxygenase TauD/TfdA [Frankia sp. EAN1pec]
Sequence
MTTTISCEPLAATVGAEVSGVDAGQLAHDDTVATAVLEALEQYGVLVFRGLHLAPETQVA
FGRRLGEIDYEQGHHPVSGIYRVTLDTSKNTSADYLRATFEWHMDGCTPLHGEPPQKATI
LSAKAVATSGGETEFANTYAAYEALSDGEKEEFGSLRVVHTMEASQRRVTPDPTPEQLQR
WRNRPTSTHPLVWTHRTGRRSLVIGANASHVVGMGLNEGPSLLQELLDRATAPDRVYRHQ
WSVGDTVIWDNTGVVHRAAPYDSHSPREMLRTTVFGDEPIR
Download sequence
Identical sequences A8LBM1
gi|158314787|ref|YP_001507295.1| 298653.Franean1_2971 WP_020460540.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]